KEGG   Phycisphaera mikurensis: PSMK_04790Help
Entry
PSMK_04790        CDS       T01800                                 

Definition
uracil-DNA glycosylase (EC:3.2.2.-)
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
phm  Phycisphaera mikurensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:phm00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    PSMK_04790
Enzymes [BR:phm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     PSMK_04790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(534144..534872)
Genome map
AA seq 242 aa AA seqDB search
MTDTADALVAAALCLRERLGPLRFAEPVHAVYQPLAYAWPMMEAYLRRFGAGRKSVLLVG
MNPGPWGMAQTGVPFGDVPSVRGFLGLEAPIGKPADEHPKRPVTGLGCPRTEVSGSRVWS
MVRARFGTPEAFFADHFVLNFCPLVFLGATGRNLTPDKLPAAEREPLLAACDEHLAEVVR
ILRPAFAVGIGVWAEKRVAAAVEAAGAGSTVGRILHPSPASPLANTDWGGQATRQLEELG
AW
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgccgatgccctcgtcgccgccgcgctctgcttgcgcgagcggctcggg
ccgctgcggttcgccgagccggtccacgccgtctaccagccgctcgcgtacgcgtggccg
atgatggaggcgtacctccgccgcttcggtgccggcaggaagagcgtgctgctggtgggc
atgaacccggggccctggggcatggcccagacgggcgtgcccttcggggacgtgccgtcg
gtccgcggcttcctcgggctcgaggcgcccatcggcaagccggccgacgagcaccccaag
cggccggtcaccggcctcggctgcccgcggaccgaggtctccggcagccgggtgtggtcg
atggtccgcgcgcgtttcggcacgcccgaggccttcttcgccgatcacttcgtcctgaac
ttctgcccgctcgtgttcctgggcgccaccggccggaacctgacccccgacaagctgccc
gccgccgagcgcgagccgctgctggccgcctgcgacgagcacctcgcggaggtggtgcgg
atcctccggccggccttcgcggtgggcatcggcgtctgggcggagaagcgggtcgcggcg
gcggtggaggcggcgggagccggatcgaccgtcggccggatcctgcaccccagcccggcg
agcccgctggcgaacacggactggggcgggcaggcgacgcggcagctcgaggagctggga
gcgtggtga

DBGET integrated database retrieval system