KEGG   Phycisphaera mikurensis: PSMK_05150Help
Entry
PSMK_05150        CDS       T01800                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSMK_05150 (tpiA)
   01230 Biosynthesis of amino acids
    PSMK_05150 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSMK_05150 (tpiA)
   00051 Fructose and mannose metabolism
    PSMK_05150 (tpiA)
   00562 Inositol phosphate metabolism
    PSMK_05150 (tpiA)
Enzymes [BR:phm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSMK_05150 (tpiA)
Exosome [BR:phm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSMK_05150 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSMK_05150 (tpiA)
  Exosomal proteins of melanoma cells
   PSMK_05150 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(573788..574567)
Genome map
AA seq 259 aa AA seqDB search
MPTPTPTRRPHIGGNWKMNLTLDAARSLAAALRDGVAGATQDRVDVTVFPAMPHLAAVAD
TLKGSPIAVGAQNAYFQPDGAFTGETSLSMLSDLGVASVLVGHSERRHVLGESDALVNEK
VLAALEAGLDVTLAIGEKLEQRENGRTDAVNAGQLALGLAGVPAERLARVTVAYEPVWAI
GTGRTASPEDAQAAHAAIRRALVSLYGADAAAGVRIQYGGSMKPGNAGDLLAGADVDGGL
IGGAALQSTDFLAIVSAAA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgcccacgccgacccccacccgccgcccccacatcggcggcaactggaagatgaatctg
acgctcgacgccgcccgctcgctcgcggcggcgctgcgggacggcgtggccggggcgacg
caggaccgggtcgacgtcacggtgttcccggcgatgccgcacctcgcggcggtcgcggac
acgctgaagggttccccgatcgccgtgggcgcgcagaacgcctacttccagcccgacggg
gccttcaccggcgagacctcgctgtcgatgctgagcgacctcggcgtcgcctccgtgctc
gtgggccactccgagcgccgccacgtcctcggcgagagcgacgccctcgtgaacgagaag
gtgctcgcggcgctggaggccggcctcgacgtcacgctcgcgatcggcgagaagctcgag
cagcgggagaacggccgcaccgacgccgtcaacgccggccagctcgcgctggggctggcc
ggcgtgcccgccgagcgcctcgcccgcgtcacggtcgcttacgagccggtctgggcgatc
ggcaccggccgcaccgccagccccgaagacgcccaggccgcccacgcggcgatccgccgg
gccctcgtctcgctctacggcgccgacgccgccgcgggcgtgcgcatccagtacggcggg
tcgatgaagcccggcaacgcgggggacctgctcgccggcgccgacgtcgacggcggcctc
atcggcggcgccgccctccagagcaccgacttcctcgcgatcgtctccgccgcggcctga

DBGET integrated database retrieval system