KEGG   Phycisphaera mikurensis: PSMK_06790Help
Entry
PSMK_06790        CDS       T01800                                 

Gene name
cysGA_hemD
Definition
uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
phm  Phycisphaera mikurensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:phm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757900..759468
Genome map
AA seq 522 aa AA seqDB search
MCLVGAGPGDPGLLTVAGLDRLRRADVVVYDALASPRLLAEAKRGADLVDVGKRARHHKM
QQDDINALLVAEARAGRSVVRLKGGDPYLFGRGAEEAAACARGGVACEVLPGVTSGLAAP
ATAGIPVTHRRVASTVTLVTGHEDPTKEGTSVDYRGLALLIARGGTACFYMGVGRLPLIA
QQLAAEGLDTATPAAVVQWGTTPRQRRCVAPLDGLAAAAAAAGVSSPAIVVVGEAAGIQE
PGLDFFTDRPLFGQRVLVTRTRQDPSRLENLLLAAGADPIEAPTLRLVAPEDPAPADAAL
RRLGPPPAASDPAAPPRFDALVLTSGNAVDALADRLDALGLDGRVLAGVELCVVGPATAA
RLHERLRLRADRLPETLTGAGVAEAFAAAGAAAGRRFLLYRADIARPELPEGLEAAGAAE
VCEVVAYESRPAASLPEEAMAALRDRSVDWLTFTSAATARNLVDLLGEERALLDAPRVAS
IGPITSEACRGLGLRVAAEAEDPSLESLTAAMAAAGPREPNA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcctcgtcggcgccggcccgggtgatccgggtctgctgacggtcgccgggctcgac
cgcctccgccgggccgacgtcgtcgtgtacgacgcgctcgcaagcccgcgcctgctcgcc
gaggcgaagcggggggccgacctcgtggacgtcggcaagcgggcccgccaccacaagatg
cagcaggacgacatcaacgccctgctcgtggccgaagcgcgggcgggacgctcggtggtc
cgcctcaagggcggcgacccgtacctcttcggacgcggcgccgaggaggcggcggcctgc
gcccgcgggggcgtcgcctgcgaggtgctgcccggggtgacctccgggctggcggcgccc
gccacggccggcatcccggtcacgcaccgcagggtcgcctcgacggtcacgctggtcacc
ggccacgaggacccgaccaaggaggggacctcggtcgactaccgcggcctcgcgctgctg
atcgcccggggcgggacggcgtgcttctacatgggcgtcggccggctgccgctcatcgcg
cagcagctcgcggcggagggcctcgacaccgcgacgcccgcggccgtcgtgcagtggggc
acgacgccgcggcagaggcgctgcgtcgccccgctggacgggctcgccgccgccgcggcg
gccgcgggcgtgtcgtcgcccgccatcgtggtggtcggcgaggccgcgggcatccaggag
cccgggctggacttcttcaccgaccgcccgctcttcggccaacgcgtgctcgtgacgcgg
acgcggcaggacccctcccgcctcgagaatctgctgctcgccgcgggcgccgacccgatc
gaggcgccgacgctgcggctggtcgcgcccgaggatcccgcccccgccgacgcggccctc
cgccggctcgggcccccgcccgccgcgtcggacccggcggcaccaccgcgcttcgacgcc
ctcgtgctgaccagcggcaacgccgtcgacgccctggccgatcgcctcgacgcgttgggc
ctcgacgggcgggtgctcgccggcgtcgagctctgcgtcgtcggccccgcgaccgccgca
cgcctgcacgagcggctccgcctgcgggcggaccggctgcccgagacgctcaccggcgcg
ggcgtcgccgaggcgttcgccgccgcgggcgccgccgccggacgccgcttcctgctgtac
cgggccgacatcgcccgccccgagctgcccgaaggtttggaggccgccggcgcggccgag
gtgtgcgaggtcgtggcgtacgagagccgacccgcggcgtcgctgccggaggaggcgatg
gcggcgctgcgcgaccgaagcgtcgactggctgaccttcaccagcgccgccaccgcccgg
aacctcgtcgacctgctcggcgaggagcgggcgctgctggacgccccccgcgtcgcctcg
atcggcccgatcaccagcgaggcctgccgcgggcttggcctccgcgtcgccgctgaagcc
gaggacccctcgctggagtcgctcaccgcggccatggcggccgcggggccgcgggagccc
aacgcttga

DBGET integrated database retrieval system