KEGG   Phycisphaera mikurensis: PSMK_07370Help
Entry
PSMK_07370        CDS       T01800                                 

Gene name
ruvA
Definition
putative Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
phm  Phycisphaera mikurensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:phm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSMK_07370 (ruvA)
Enzymes [BR:phm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PSMK_07370 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(828299..828961)
Genome map
AA seq 220 aa AA seqDB search
MLARLSGTLVDVDPRGNLGLVDPGHGLTYEVLLPAFVTTRLVPREGQALTLHTLHFLEGS
SQGTTLFPRIAGFATREDKAFFELFVTVKGIGHRRALRAMVFAPSTLAAAIADRDLKLIQ
TMPEVGKRLAETIVVTLKGKVDPWIGGAATPSKPIRDALEPDAVATSPSGGTLARDALEV
LTQLGEPRTEALQSIERLLSADDAPADVEALIAAVYAARS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcctctccggcaccctcgtcgacgtcgacccgcgcggaaacctgggcctg
gtggatcccggccacgggctgacgtacgaggtgctgctgccggccttcgtgacgacgcgg
ctggtgcccagagagggccaagcgctgacgctgcacacgctgcacttcctggagggcagc
agccaggggacgacgctcttcccgcggatcgccggcttcgcgacgcgcgaggacaaggcc
ttcttcgagctgttcgtgaccgtgaagggcatcggccaccgccgcgccctccgcgcgatg
gtcttcgccccgtccaccctcgccgccgccatcgccgaccgcgacctgaagctgatccag
acgatgcccgaggtcggcaagcgcctcgcggagaccatcgtcgtcacgctcaagggcaag
gtcgatccgtggatcggcggcgccgccacgccgagcaagccgatccgggacgcgttggag
cccgacgccgtcgccacctccccatccggcggcaccctcgcccgcgacgccctggaggtc
ctcacccagctcggcgagccgcggaccgaagccctccagagcatcgaacgcctcctgtcc
gcggacgacgcccccgcggacgtcgaagccctcatcgccgccgtctacgcggcgaggagc
tga

DBGET integrated database retrieval system