KEGG   Phycisphaera mikurensis: PSMK_07920Help
Entry
PSMK_07920        CDS       T01800                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
phm  Phycisphaera mikurensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:phm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(911058..911969)
Genome map
AA seq 303 aa AA seqDB search
MSKAGEAVVLRCPAKLNLFLHVGPPAEAGGRHPVLSAMAAIDLVDDLEAERRDGAGLSLA
RTWAASAAAPTPLDWPAERDLAWRAAEAFAAEAGTRPDVRLTLSKRIPCGGGLGGGSADA
AGVLAAMDRLWPGAVEEAALTGLAAGLGSDVPFALAAIRGRPLALVGGFGEAVQPLPRPP
GAGLHAALVFPAFGCPTGSVFAAFDAAPPAGRSDPGKARAAAEAGWRALAALGNALAEPA
CAVRPALRRVLEALAGAGLDARITGSGSTVFVLAEDAAQAADAARRAGAATGLPAVAVSG
WPR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaagcgggcgaggcggtcgtcctgcgttgcccggcgaagctgaacctcttcctg
cacgtcggccccccggcggaggcgggcgggcggcacccggtgctgtcggccatggccgcg
atcgacctggtggacgacctggaggcagagcgacgcgacggcgcggggctgtcgctggcg
cgcacctgggcggcctcggcggccgcgcccacgccgctggactggccggcggagcgggac
ctcgcctggcgggccgccgaggctttcgccgcggaggcgggcacgcggccggacgtccgg
ctcacgctgagcaagcggattccctgcggcggcgggctcggcgggggctcggccgacgcg
gcgggcgtgctcgcggcgatggaccggctgtggccgggggcggtggaggaggcggcgctc
accgggctcgcggccggcctcggcagcgacgtccccttcgcgctggccgcgatccgcggg
cggccgctggcgctggtcggcggcttcggcgaggcggtccaaccgctcccgcgcccgccc
ggggccgggctgcacgcggcgctggtgttcccggcgttcggctgcccgacgggctcggtc
ttcgccgccttcgacgcggcaccgcccgcgggccggtcggatcccgggaaggcccgggcg
gcggcggaggcgggctggcgggcgctggcggcgctcggcaacgccctggcggagccggcg
tgcgcggtgcggccggccctgcggcgggtgctcgaggcgttggcgggggcggggctggac
gcgaggatcaccggctcgggcagcaccgtcttcgtgctcgccgaggacgcggcgcaagcg
gccgacgcggcgaggcgggcgggggcggcgacggggctgccggcggtggcggtcagcggc
tggccgcggtga

DBGET integrated database retrieval system