KEGG   Phycisphaera mikurensis: PSMK_07920Help
Entry
PSMK_07920        CDS       T01800                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00900  Terpenoid backbone biosynthesis
phm01100  Metabolic pathways
phm01110  Biosynthesis of secondary metabolites
phm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSMK_07920 (ispE)
Enzymes [BR:phm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSMK_07920 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAM02951
UniProt: I0ICG3
Position
complement(911058..911969)
Genome map
AA seq 303 aa AA seqDB search
MSKAGEAVVLRCPAKLNLFLHVGPPAEAGGRHPVLSAMAAIDLVDDLEAERRDGAGLSLA
RTWAASAAAPTPLDWPAERDLAWRAAEAFAAEAGTRPDVRLTLSKRIPCGGGLGGGSADA
AGVLAAMDRLWPGAVEEAALTGLAAGLGSDVPFALAAIRGRPLALVGGFGEAVQPLPRPP
GAGLHAALVFPAFGCPTGSVFAAFDAAPPAGRSDPGKARAAAEAGWRALAALGNALAEPA
CAVRPALRRVLEALAGAGLDARITGSGSTVFVLAEDAAQAADAARRAGAATGLPAVAVSG
WPR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaagcgggcgaggcggtcgtcctgcgttgcccggcgaagctgaacctcttcctg
cacgtcggccccccggcggaggcgggcgggcggcacccggtgctgtcggccatggccgcg
atcgacctggtggacgacctggaggcagagcgacgcgacggcgcggggctgtcgctggcg
cgcacctgggcggcctcggcggccgcgcccacgccgctggactggccggcggagcgggac
ctcgcctggcgggccgccgaggctttcgccgcggaggcgggcacgcggccggacgtccgg
ctcacgctgagcaagcggattccctgcggcggcgggctcggcgggggctcggccgacgcg
gcgggcgtgctcgcggcgatggaccggctgtggccgggggcggtggaggaggcggcgctc
accgggctcgcggccggcctcggcagcgacgtccccttcgcgctggccgcgatccgcggg
cggccgctggcgctggtcggcggcttcggcgaggcggtccaaccgctcccgcgcccgccc
ggggccgggctgcacgcggcgctggtgttcccggcgttcggctgcccgacgggctcggtc
ttcgccgccttcgacgcggcaccgcccgcgggccggtcggatcccgggaaggcccgggcg
gcggcggaggcgggctggcgggcgctggcggcgctcggcaacgccctggcggagccggcg
tgcgcggtgcggccggccctgcggcgggtgctcgaggcgttggcgggggcggggctggac
gcgaggatcaccggctcgggcagcaccgtcttcgtgctcgccgaggacgcggcgcaagcg
gccgacgcggcgaggcgggcgggggcggcgacggggctgccggcggtggcggtcagcggc
tggccgcggtga

DBGET integrated database retrieval system