KEGG   Phycisphaera mikurensis: PSMK_09600Help
Entry
PSMK_09600        CDS       T01800                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
phm  Phycisphaera mikurensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PSMK_09600
  Lipid metabolism
   00561 Glycerolipid metabolism
    PSMK_09600
   00600 Sphingolipid metabolism
    PSMK_09600
Enzymes [BR:phm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PSMK_09600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1127611..1129659)
Genome map
AA seq 682 aa AA seqDB search
MSDTAPPPTPPLRLDDCHASWSGGVLEVGNAAITRRWRIAGGVPLAASLRDERSKREWLV
RERADAGADADAAGFTLAPDPRPAPPAQAPALRVVLASPDRRLHVAIFPGLAVVRTRHAQ
RADGSDAAGAAGTAAIGTSDGVEMEGVEPAARATDARARNVIERLPLAPAHLRLEAVELH
GRTDERCEVVQPRRFGRLRGERKLALDGNLFALVEPFSGDGLVLLRHGLLPGSAPPGRRQ
RPDLLADAGTLELTEEPLQPDAEEGWRIGDWHAVVLHGGGVAGRVAALQHHEHRLRVPTA
ADRWMVSNTWGDRGRDGRVGEAFVLGEIEAAAELGVDVVQIDDGWQAGRSANSTEAGGKW
SGFFESEGFWSPHPDRFPRGLTPLVDAARARGVRLGLWYAPDSSADFANWRRDAQTLLGL
HRTLGVTHFKIDAVVIDSGLGESRFHRMIDRVLAGAGGDERITLDLDATAGKRPDFLGRP
DAGPVFVQNRYTDWGSWFPHLTLRTLWQLARWVEPSRLRMEWLNPDRNPDRYADDALAPR
GCSAAYAFASVMVAAPLAWMELQRLAPERRREAGPVIRAWREARADWVGATVVPVGDEPD
GFGWTGFAVAPADPSRPRHLLAFRENHPASERTLGLPWDAIGPARLRLPAAAEALEPCGR
ELRLRLPRARSFGWWTLAPARA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccgccccgccgccgacaccgccgctgcgtctggacgattgccacgcctcg
tggagcggcggcgtgctggaggtcggcaacgccgcgatcacgcggcgctggcggatcgca
ggcggcgtcccgctcgctgcgagcctccgcgacgagcggtcgaagcgggagtggctcgtg
cgggagagggcggacgccggtgccgacgccgatgccgcgggcttcacccttgcgccggat
ccgcggcccgcgcctccggctcaggctcccgccctgcgggtcgtgctcgcctcgccggac
cggcggctgcacgtcgcgatcttcccggggctggcggtggtgcgtacgcggcacgcccag
cgggccgatggctcggacgcggcgggcgcggcgggcacggcggcgatcgggaccagcgac
ggcgtggagatggagggtgtggagccggcggcccgggccaccgacgcccgcgccaggaac
gtgatcgagcggctgccgctggctcccgcccatctccggctcgaagcggttgagctgcac
ggccgcaccgacgagcggtgcgaggtggtgcagccgcggcgcttcggccggctgcgcggc
gagcggaagctcgcgctcgacggcaacctcttcgccctggtggaaccgttctccggcgac
gggctcgtcctgctccgccacgggctcctgccgggttcggcaccgccgggccggaggcaa
cggcccgacttgctcgccgacgccggcacgctggagctgaccgaggagccgctgcaaccc
gacgcagaagagggctggcggatcggcgactggcacgccgtcgtgctccacggcggcggc
gtcgccggccgcgtcgccgcgctgcagcaccacgagcaccggctccgcgtgccgaccgcg
gccgaccgctggatggtcagcaacacctggggcgaccgcggccgggacggccgcgtgggc
gaggcgttcgtcctcggggagatcgaagccgccgccgaactcggcgtcgacgtcgtgcag
atcgacgacggctggcaggccgggcgctccgccaactccaccgaggcgggcgggaagtgg
tcgggcttcttcgagagcgagggcttctggtcgccccacccggatcgcttcccgcggggg
ctgacaccgctggtcgacgccgcgcgggcgcgtggcgtgcggctggggctgtggtacgcg
cccgactcctccgcggacttcgccaactggcgccgcgacgcccagacgcttcttggcctg
caccgcacgctcggcgtcacccacttcaagatcgacgcggtcgtcatcgacagcggcctc
ggcgagtcgcggtttcaccggatgatcgaccgggtgctggccggcgccggcggcgacgag
cgcatcacgctggacctcgacgccaccgccggcaagcggccggacttcctggggcggccc
gacgccggtccggtcttcgtccagaaccgctacaccgactggggcagctggttcccgcac
ctcaccctccgcacgctctggcagctcgcccgctgggtcgagcccagccggctgcggatg
gagtggttgaaccccgaccgcaacccggaccgctacgccgacgacgcgctcgcgccgcgg
ggttgctccgccgcctacgccttcgcctcggtcatggtcgcggcgccgctggcttggatg
gagttgcagcgcctcgcgcccgagcggcggcgggaggccgggcccgtgatccgggcgtgg
cgagaggcgcgggccgactgggtcggcgcgaccgtcgtccccgtcggcgacgagcccgat
ggattcggctggaccggcttcgcggtcgcgccggccgacccctcgcgcccgcgtcacctg
ctcgcgttccgcgagaatcaccccgcttccgagcggacgctcggccttccctgggacgcc
atcggaccggcacggctccgcctccccgccgccgcggaggctctggaaccgtgcggacgc
gagctccgcctccgcctcccgcgggcccggtccttcggctggtggacgctcgccccggcc
cgggcctga

DBGET integrated database retrieval system