KEGG   Phycisphaera mikurensis: PSMK_12750Help
Entry
PSMK_12750        CDS       T01800                                 

Definition
(GenBank) aminopeptidase
Organism
phm  Phycisphaera mikurensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAM03434
UniProt: I0IDU6
Position
complement(1500996..1502075)
Genome map
AA seq 359 aa AA seqDB search
MNLDLLKRLSETAAVPGREHRVRALLEEEAAGLFDTVTTDPLGSLVCVRSARGPAAEPPQ
RVMVAAHMDQIGFLVRFIDDDGFLRVQPVGGFDIRNLFARVVTICPDPADPSRDLRGLMN
PGVKPVHLATEEDRKKLPDLTDLVIDTTLPAEEVKKRVKIGDMVVLDQPFVDLGPAVAGQ
AMDNRVACWALVEAVRKLEADATPHPCELHCVFTVQEEVGLRGALTSAYTARPHVGIAVD
TTLCVDTPGGVPHQQTTAFGKGVALTVMDSASIADVGILQAFERLGEANGVPTQRSILMR
GGTDAGSLQRAGVGARTFTLSVPTRNIHSVTEACHKADLEACRDLLALFLAEAVPSAPG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgatctgttgaagcgactctccgagaccgccgccgtgcccggccgcgagcac
cgcgtgcgggcgctgctggaggaggaggcggccggcctcttcgacacggtcacgacggac
ccgctgggctcgcttgtgtgcgtgcgctcggcgcgggggccggctgcggagccgccgcag
cgggtgatggtcgccgcccacatggaccagatcggcttcctcgtccgcttcatcgacgac
gacggcttcctccgcgtgcaaccggtgggcggcttcgacatccgcaacctcttcgcccgg
gtcgtgacgatctgccccgatcccgcggatccgtcacgggacctccgcggtctcatgaac
cccggcgtgaagccggtgcacctcgcgaccgaggaagaccgcaagaagctgcccgacctc
accgacctggtgatcgacaccacgctcccggcggaggaggtcaagaagcgcgtgaaaatc
ggcgacatggtcgtcctcgatcagcccttcgtggacctgggccccgccgtcgcgggccag
gcgatggacaaccgcgtcgcctgctgggcgctggtggaagccgtccggaagctggaggcc
gacgccacgccgcacccctgcgagctgcactgcgtgttcaccgtccaggaggaggtcggc
ctgcgtggcgccctcaccagcgcctacaccgcccggccgcacgtcggcatcgccgtggac
accaccctctgcgtcgacacccccggcggcgtcccgcaccagcagacgaccgccttcggc
aagggcgtcgccctcaccgtgatggactccgccagcatcgccgacgtggggatcctccag
gcgttcgagcggctcggcgaggcgaacggcgtgcccacccagcgcagcatcctgatgcgg
ggcggcaccgatgccggcagcctccagcgcgccggcgtcggtgcccgcaccttcacgctc
tcggtgcccacccgcaacatccactccgtgaccgaggcctgccacaaggcggacctggag
gcgtgccgggacctgctcgcgctgttcctggcggaagcggtcccgtccgcaccgggatga

DBGET integrated database retrieval system