KEGG   Phycisphaera mikurensis: PSMK_13330Help
Entry
PSMK_13330        CDS       T01800                                 

Definition
putative hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
phm  Phycisphaera mikurensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSMK_13330
Enzymes [BR:phm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PSMK_13330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1564245..1565423
Genome map
AA seq 392 aa AA seqDB search
MNDSHHTPPASEPLDPKQMKGYLAALKEESIPNKTYLEEMKRQVEIGLPGADSIGDKTIS
TFSRGELPHYAGINTLLKLKYLEDVREVGNYDVAFLGIPFDIGTTYRSGTRFGPQAMRRI
SALYTSYFYELGVDLVENVRMCDLGDVFTIGNIEKSFDQVSRAVSHVYSSGCFPFLMGGD
HSLGYPNVRGIAPHVDGDIGIIHIDRHIDIQEKDMDERMHTCPWFHATNIPNAPAKNLVQ
VGIGGWQVPRPGVKIARERGTNIISMDDVDDHGIDKVAEMALEMAWKGNVKAVYLSFDID
SVDCGFVPGTGWPEPGGFLPREVLKLLKLVAREGICAMEVVEVSPAYDTSDITALLGVRA
MLDVLATMVDEGILPRKEKAVSDAGIDGWKGT
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactctcaccacacgccgcccgcttccgagcccctcgatcccaagcagatgaag
ggctacctcgcggcactcaaggaggagtcgattcccaacaagacgtacctggaggagatg
aagcggcaggtcgagatcggcctgcccggggcggattccatcggcgacaagacgatcagc
accttctcgcggggcgagctgccgcactacgccggcatcaacacgctgctgaagctgaag
tacctcgaagacgtccgcgaggtcgggaactacgacgtcgccttcctgggcatccccttc
gacatcggcaccacctaccgctcgggcacgcgcttcgggccgcaggcgatgcgccggatc
tccgctctctacaccagctacttctacgagctcggcgtggacctggtggagaacgtgaga
atgtgcgacctgggcgacgtcttcacgatcggcaacatcgagaagagcttcgaccaggtc
tcccgcgcggtcagccacgtctacagctccggctgcttcccctttctcatgggcggcgac
cactcgctgggctatccgaacgtgcgcggcatcgcgccgcacgtcgacggcgacatcggg
atcatccacatcgaccgtcacatcgacatccaggagaaggacatggacgagcggatgcac
acgtgcccgtggttccacgcgaccaacatccccaacgccccggcgaagaacctggtgcag
gtgggcatcggcggctggcaggtgccgcggccgggcgtgaagatcgcccgcgagcgcggc
acgaacatcatctccatggacgacgtggacgaccacggcatcgacaaggtcgccgagatg
gcgctggagatggcgtggaagggcaacgtgaaggcggtctacctctccttcgacatcgac
agcgtcgactgcggcttcgtgccgggcaccggctggcccgagcccggcggcttcctgccg
cgcgaggtgctcaagctgctcaagctcgtggcgagggagggcatctgcgcgatggaggtc
gtcgaggtctcacccgcgtacgacacctccgacatcaccgcgctcctgggcgtccgggcg
atgctcgacgtgctggcgacgatggtggacgaggggatcctgccccggaaggagaaggcc
gtctcggacgcgggcatcgacgggtggaaggggacgtga

DBGET integrated database retrieval system