KEGG   Phycisphaera mikurensis: PSMK_13390Help
Entry
PSMK_13390        CDS       T01800                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
phm  Phycisphaera mikurensis
Brite
Enzymes [BR:phm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PSMK_13390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1569854..1571044
Genome map
AA seq 396 aa AA seqDB search
MADRRAVALPAVAAGLVAGLGLLAGATAPADDPSAADLRAIYSQPPAAWPAATVDEGVEP
RELGLLPELPEADEKLVGLGEMLFFDPRLSTTGQMACASCHDPDLGWADGRTTSFGFRRT
QLPRNAPTIQNSGHLHPLFWDGRAGSLEELTLEVIEHPDEMRGTGTAVVERLSAVPAYAE
AFAEIPGEPGVTIEKVTSAVAAFCRSVNGGKSRFDAFLRGRETALTDAELRGLHLYRTEA
RCMNCHDGPEMSDGKLHVTGLSLSGTPREDLGAYAVTGRPEDSGAFRTPTLRNIAKTGPY
MHHGLFESLPVTLRAYNGGMPTQRDRINDPADPVPVKSPLLHELGLDDAQLGDLEAFLRS
TTEPHRLVLPPDLPPHADDAPPPAIPPDAEAGHARP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcggcgggcggtggcgctgcccgcggtcgccgcgggcttggtggcgggcctg
ggcctgctcgccggagcgaccgcgcccgcggacgatccctccgcggccgacctccgcgcg
atctacagccagccgccggcggcgtggccggcggccaccgtggacgagggggtggagccg
cgggagctgggcctgctgccggaactgcccgaagcggacgagaagctcgtcgggctcggc
gagatgctcttcttcgatccgcggctctcgacgaccgggcagatggcctgcgccagctgc
cacgacccggacctgggttgggccgacgggcggacgaccagcttcggcttccggcggacg
cagctcccgcggaacgccccgacgatccagaacagcgggcacctgcacccgctgttctgg
gacgggcgggccgggagcctcgaggagctgacgctcgaggtcatcgagcaccccgacgag
atgcgtggcaccggcacggcggtggtcgagcggctgtcggcggtgccggcgtacgccgag
gccttcgccgagatcccgggcgagcccggcgtcacgatcgagaaggtgacctccgccgtc
gccgcgttctgccgcagcgtcaacggcgggaagagccgcttcgacgccttcctgcgcggg
cgggagacggcgctgaccgacgcggagctgcggggcttgcacctctaccgcaccgaggcg
aggtgcatgaactgccacgacggcccggagatgagcgacggcaagctgcacgtcaccggg
ctgtcgctgtcgggcacgccgcgggaggacctcggcgcctacgccgtgaccgggaggccc
gaggacagcggcgccttccgcacgccgacgctgcggaacatcgccaagaccggcccgtac
atgcaccacggcctcttcgagagcctgcccgtcacgctccgcgcgtacaacggcgggatg
cccacccagcgggaccgcatcaacgaccccgccgaccccgtgccggtgaagagcccgctg
ctgcacgagctggggctggacgacgcgcagctcggagacctcgaggccttcctccgctcg
accaccgagccgcaccgcctggtgctgcccccggacctcccgccgcacgccgacgacgct
ccgccgccggcgattcctcctgacgccgaggccggccacgcgaggccgtag

DBGET integrated database retrieval system