KEGG   Phycisphaera mikurensis: PSMK_13400Help
Entry
PSMK_13400        CDS       T01800                                 

Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
phm  Phycisphaera mikurensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSMK_13400
Enzymes [BR:phm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PSMK_13400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1571159..1573558)
Genome map
AA seq 799 aa AA seqDB search
MPDPPSEAFGAPGIEPRWTSSAKVGVGTAYHTASRLWFTLSHGVVNEVYHPTADQPNTRD
LQLLITDGETFLHEERRDLTHAVERPDEDTLAYRLTNTDPGGRYRVVKDVLSDPHQPVLL
QRIRLEVLDSTYAEKLRVFALLAPHAGGSGRGNHAAACDLAGEPLLRAWRDGTHLAMGAR
PGFLRRSVGYSGSSDGYQDLQDGFDLAWSFTEARDGTVALTGELDLSAPGRTAVLGLGFG
DSATSSACALLQALGDRFDEKRESFLRQWKRLDDGCDGTLNRLEAQCGDGGGLARLSRCV
LLAHEDKTYQGAMTASLSIPWGAHQSDADPGGYHLVWPRDLLHAATALLAAGETATPRRA
MTYLACLQQADGGIPQNAWLDGEPFWPGLQLDEVAAPALLAWRLRRAGACEGLATPAVVR
RAAAKLIHSGPVTPQERWEENSGYSPSTLATCVAALCVAAEGFAEAGEAAAAAFVHDYAD
WLAAHVEAWTVTTRGTLVDGEPRHFVRINPAEAGDTPVPGSVDTAEVRLKNGGGTHPARD
VVDLGFLQLVRYGVRPADDATVAASVRVADAVLKHDLPGGPGYLRYNHDGYGQKRDGSAF
DTEGVGGCWPLLTGERGLYALAAGEPAGPYLDALAAFANPGGMLPEQLWRFPDDPDHDLE
FGGPAGSAMPLCWSHATYLNLARSLCDGEPFDRIGPCHDRYARDGRRGFDATFWCPAHPI
AEADAAKPLRIVSDRPGTLRWTVDGWDTSTDTPLTAPLPLVHAAELRPADLPAGGTLRFT
LHHADGGGLGRNFDVRLTG
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccctccgagcgaagccttcggcgccccgggcatcgaaccccggtggacgtcg
agcgcgaaggtcggcgtgggcaccgcctaccacaccgcctcacgcctctggttcacgctc
agccacggcgtcgtcaacgaggtctaccacccgaccgccgatcagccgaacacccgcgac
ctccagctgctcatcaccgacggcgagacgttcctccacgaggagcgccgcgacctgacg
cacgccgtcgagcggcccgacgaagacaccctcgcctaccgcctcaccaacaccgatccc
ggcggccgctaccgcgtggtgaaggacgtgctgagcgacccgcaccagccggtgctgctc
cagcggatccggctggaggtcctcgattccacctatgcggagaagctgcgcgtcttcgcc
ctgctcgccccccacgccgggggctcgggccgcggcaaccacgccgccgcctgcgacctc
gccggcgagccgctgctgcgtgcctggcgcgacggcacgcacctggcgatgggagcccgc
cccggcttcctccgccgctcggtggggtacagcggctccagcgacggctaccaggacctc
caggacggcttcgacctcgcgtggagcttcacggaggcccgcgacggcaccgtcgccctc
accggcgagctggacctctcggcgcccggccgcaccgccgtgctcgggctgggcttcggc
gactccgccaccagctccgcctgcgcgctgctccaggccctcggcgaccgcttcgacgag
aagcgggagagcttcctgcgccagtggaagcgcctcgacgacggctgcgacggcacgctg
aaccggctggaggcgcagtgcggcgacggcggcggcctcgcccgcctgtcccgctgcgtg
ctgctcgctcacgaggacaagacctaccagggcgcgatgaccgcctcgctgtcgatcccc
tggggcgcgcaccagagcgacgccgaccccggcggctaccacctcgtctggccgcgcgac
ctcctgcacgccgccaccgccctgctcgccgccggcgagaccgcgacgccgcggcgggcg
atgacctacctcgcctgcctgcagcaagccgacggcggcatcccgcagaacgcctggctc
gacggcgagcccttctggccgggcctgcagctcgacgaggtcgccgcgcccgcgctgctg
gcttggcgtctccgccgcgccggcgcctgcgagggcctggccacgcccgcggtcgtccgg
cgggccgcggcgaagctcatccacagcggcccggtgacgccgcaggaacgctgggaggag
aacagcggctactcgccctccacgctggcgacctgcgtcgccgccctctgcgtcgcggcc
gagggcttcgcggaggccggcgaggccgcagccgcggccttcgtgcacgattacgccgat
tggctcgccgcgcacgtcgaggcctggaccgtcaccacccgcggcacgctcgtcgatggc
gagccgcggcacttcgtccgcatcaaccccgccgaggcgggcgacacgcccgtgcccgga
tccgtggataccgccgaggtgcggctgaagaacggcggggggacccacccggcgcgcgac
gtcgtcgatctgggcttcctccagctcgtccgctacggcgtccgccccgccgacgacgcc
accgtcgccgccagcgtgcgcgtggccgacgccgtgctcaagcacgacctgcccggcggc
cccggctacctccgctacaaccacgacggctacgggcagaagcgggacggctccgccttc
gacaccgagggcgtgggcggctgctggccgctgctcaccggcgagcgcggcctctacgcc
ctcgccgccggcgagcccgccgggccctacctcgacgcgctcgccgcgttcgccaacccc
ggcgggatgctgcccgagcagctctggcgcttccccgacgaccccgaccacgatctggag
ttcggcggccccgccgggtcggcgatgccgctgtgctggtcgcacgcgacctacctgaac
ctcgcccggagcctctgcgacggcgaacccttcgaccgcatcggcccctgccacgaccgg
tacgcccgggacggccggcgcggcttcgacgccaccttctggtgccccgcccaccccatc
gccgaggccgacgccgccaagccgctgcgtatcgtctccgaccgccccggcaccctccgc
tggaccgtcgacgggtgggacacctccaccgacaccccgctcaccgccccgctccccctc
gttcacgccgccgaactccgacccgccgacctgcccgccggcggcacgctccgcttcacc
ctgcaccacgcggacggcggcgggctcggcaggaacttcgacgtccggctgaccggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system