KEGG   Phycisphaera mikurensis: PSMK_13480Help
Entry
PSMK_13480        CDS       T01800                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
phm  Phycisphaera mikurensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSMK_13480 (folK)
Enzymes [BR:phm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSMK_13480 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581012..1581551
Genome map
AA seq 179 aa AA seqDB search
MGRRGSAVTEHAWVALGSNLGDRGAHLLAACRRLAAAPGVASLVRGPFRETPALVLPGTP
PQPAYLNAAARLETTLGPAALLDRLQAVEAALGRPAGSGRGVWAPRTVDLDLLFHGRSAA
SDARLTLPHPRWARRAFVLLPILDVEPGFVSPEPRPRAAGRLLRGLWGATSAASTPPPA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtgggacgccgcgggagcgcggtgaccgagcacgcctgggtggcgctggggtcgaacctg
ggcgaccgcggcgcgcacctgcttgcggcgtgccgccggctcgccgcggctccgggcgtg
gcgagcctcgtgcgggggccgttccgggagacgccggcgctggtgctcccggggacgccg
ccgcagccggcgtacctcaacgcggcggcgcgcctggagacgacgctgggccccgcggcg
ttgctggaccggctgcaggcggtcgaggcggcgctggggcggccggcgggttccggccgc
ggggtgtgggcgccgcggaccgtcgacctggacctgctgttccacgggcggtccgcggcg
tcggacgcccggctcacgctgccgcacccgcgatgggcccggcgggccttcgtcctgctc
ccgatcctggacgtggagccgggcttcgtcagccccgagccgcggccgcgggcggcgggc
cgcctgctgcgcgggctctggggtgcaacgagcgccgcgtcgacgccgccgcccgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system