KEGG   Phycisphaera mikurensis: PSMK_14210Help
Entry
PSMK_14210        CDS       T01800                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
phm  Phycisphaera mikurensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:phm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:phm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670728..1671222
Genome map
AA seq 164 aa AA seqDB search
MPIHLIYARSLDHCIGRDGGLPWRLPADFRHFKRTTLGHPIVMGRKTYGDHQSVLPGRTN
VVLSRDPGFRGADGIVVRHDLEAALDEYGAGGRLAFVIGGAGVFSAAFPRAEAVIETIVR
TEVPEGDVRVEAFDFAGWRSEKILEHGADERHAFAFEVWERKRP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgccgatccacctgatctacgcccgctctctggaccactgcatcggccgcgacggcggc
ctgccgtggcggctgcccgcggacttccggcacttcaagcggacgacgctgggccacccg
atcgtgatgggccgcaagacctacggcgaccaccagagcgtgctgcccggccgcaccaac
gtcgtcctcagccgcgaccccggcttccgcggggccgacggcatcgtggtccgccacgac
ctcgaagccgcgctggacgagtacggcgccggcggccgcctcgccttcgtcatcggcggc
gccggcgtcttctccgccgccttcccccgcgccgaggcggtgatcgagacgatcgtgcgg
accgaggtccccgagggcgacgtccgcgtggaagccttcgacttcgccggctggcggagc
gagaagatcctcgagcacggcgcagacgagcggcacgcattcgccttcgaggtttgggag
cggaagaggccctga

DBGET integrated database retrieval system