KEGG   Phycisphaera mikurensis: PSMK_15810Help
Entry
PSMK_15810        CDS       T01800                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00260  Glycine, serine and threonine metabolism
phm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
phm01100  Metabolic pathways
phm01110  Biosynthesis of secondary metabolites
phm01130  Biosynthesis of antibiotics
phm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSMK_15810 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSMK_15810 (trpA)
Enzymes [BR:phm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSMK_15810 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: BAM03740
UniProt: I0IEQ2
Position
1859774..1860592
Genome map
AA seq 272 aa AA seqDB search
MPSRVKDSFAALRSSGRRGLMPFVTAGDPSLDDLPDLLAALEAGGATAVEVGIPFSDPVA
DGPVIAESMQHALRGGVTVAAVFAAVREARRRVSIPLVAMLSYSIVYRLGLDRFCEEAAA
AGFDGLIIPDLAVEESAESAAAAARAGLTLSLLVAPSTPPKRAARLAEASTGFVYVVSRA
GITGADKDVPEGLAERVAGLRAATDLPLAVGFGIASAAQVRQVVGAADAAIVGSALVRRL
AGFRGDGHAAAADAARAFVAELAAGLPAPAAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccctcccgcgtcaaggactccttcgccgccctccgctcctccggtcgccgcggcttg
atgcccttcgtgacggcgggggatccgtcgctggacgacctgcccgacctgctggcggcg
ctggaagccgggggcgcgacggcggtggaggtggggatccccttcagcgacccggtggcg
gacggcccggtcatcgcggagtcgatgcagcacgcgctgcgggggggcgtgaccgtggcg
gctgttttcgcggccgtccgggaggcgcggcggcgggtgtcgatcccgctggtggcgatg
ctgagctactcgatcgtctaccggctgggcctggaccgcttctgcgaggaagccgcggct
gcgggcttcgacgggctcatcatcccggacctcgccgtcgaagaatcggcggaatcggcg
gcggccgcggcgcgggcggggctgacgctgagcctcctggtggccccgtcgacgccgcca
aagcgggcggcgcggctggcagaggcgagcacgggcttcgtgtacgtcgtcagccgcgcg
ggcatcaccggggccgacaaggacgtgccggaggggctggcggagcgggtggcgggcttg
cgggccgcgacggacctcccgctggccgtgggcttcggcatcgcctcggcggcgcaggtc
cgccaggtggtgggcgcagcggacgcggccatcgtcggctcggcgctggtccgccggctc
gcgggcttccggggcgacgggcacgccgcggcggccgacgcggcgcgggcgttcgtcgcc
gagctcgcggcgggcctgccggctccggcggcggcatga

DBGET integrated database retrieval system