KEGG   Phycisphaera mikurensis: PSMK_15810Help
Entry
PSMK_15810        CDS       T01800                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:phm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:phm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:phm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1859774..1860592
Genome map
AA seq 272 aa AA seqDB search
MPSRVKDSFAALRSSGRRGLMPFVTAGDPSLDDLPDLLAALEAGGATAVEVGIPFSDPVA
DGPVIAESMQHALRGGVTVAAVFAAVREARRRVSIPLVAMLSYSIVYRLGLDRFCEEAAA
AGFDGLIIPDLAVEESAESAAAAARAGLTLSLLVAPSTPPKRAARLAEASTGFVYVVSRA
GITGADKDVPEGLAERVAGLRAATDLPLAVGFGIASAAQVRQVVGAADAAIVGSALVRRL
AGFRGDGHAAAADAARAFVAELAAGLPAPAAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccctcccgcgtcaaggactccttcgccgccctccgctcctccggtcgccgcggcttg
atgcccttcgtgacggcgggggatccgtcgctggacgacctgcccgacctgctggcggcg
ctggaagccgggggcgcgacggcggtggaggtggggatccccttcagcgacccggtggcg
gacggcccggtcatcgcggagtcgatgcagcacgcgctgcgggggggcgtgaccgtggcg
gctgttttcgcggccgtccgggaggcgcggcggcgggtgtcgatcccgctggtggcgatg
ctgagctactcgatcgtctaccggctgggcctggaccgcttctgcgaggaagccgcggct
gcgggcttcgacgggctcatcatcccggacctcgccgtcgaagaatcggcggaatcggcg
gcggccgcggcgcgggcggggctgacgctgagcctcctggtggccccgtcgacgccgcca
aagcgggcggcgcggctggcagaggcgagcacgggcttcgtgtacgtcgtcagccgcgcg
ggcatcaccggggccgacaaggacgtgccggaggggctggcggagcgggtggcgggcttg
cgggccgcgacggacctcccgctggccgtgggcttcggcatcgcctcggcggcgcaggtc
cgccaggtggtgggcgcagcggacgcggccatcgtcggctcggcgctggtccgccggctc
gcgggcttccggggcgacgggcacgccgcggcggccgacgcggcgcgggcgttcgtcgcc
gagctcgcggcgggcctgccggctccggcggcggcatga

DBGET integrated database retrieval system