KEGG   Phycisphaera mikurensis: PSMK_15810Help
Entry
PSMK_15810        CDS       T01800                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSMK_15810 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSMK_15810 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSMK_15810 (trpA)
Enzymes [BR:phm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSMK_15810 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1859774..1860592
Genome map
AA seq 272 aa AA seqDB search
MPSRVKDSFAALRSSGRRGLMPFVTAGDPSLDDLPDLLAALEAGGATAVEVGIPFSDPVA
DGPVIAESMQHALRGGVTVAAVFAAVREARRRVSIPLVAMLSYSIVYRLGLDRFCEEAAA
AGFDGLIIPDLAVEESAESAAAAARAGLTLSLLVAPSTPPKRAARLAEASTGFVYVVSRA
GITGADKDVPEGLAERVAGLRAATDLPLAVGFGIASAAQVRQVVGAADAAIVGSALVRRL
AGFRGDGHAAAADAARAFVAELAAGLPAPAAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccctcccgcgtcaaggactccttcgccgccctccgctcctccggtcgccgcggcttg
atgcccttcgtgacggcgggggatccgtcgctggacgacctgcccgacctgctggcggcg
ctggaagccgggggcgcgacggcggtggaggtggggatccccttcagcgacccggtggcg
gacggcccggtcatcgcggagtcgatgcagcacgcgctgcgggggggcgtgaccgtggcg
gctgttttcgcggccgtccgggaggcgcggcggcgggtgtcgatcccgctggtggcgatg
ctgagctactcgatcgtctaccggctgggcctggaccgcttctgcgaggaagccgcggct
gcgggcttcgacgggctcatcatcccggacctcgccgtcgaagaatcggcggaatcggcg
gcggccgcggcgcgggcggggctgacgctgagcctcctggtggccccgtcgacgccgcca
aagcgggcggcgcggctggcagaggcgagcacgggcttcgtgtacgtcgtcagccgcgcg
ggcatcaccggggccgacaaggacgtgccggaggggctggcggagcgggtggcgggcttg
cgggccgcgacggacctcccgctggccgtgggcttcggcatcgcctcggcggcgcaggtc
cgccaggtggtgggcgcagcggacgcggccatcgtcggctcggcgctggtccgccggctc
gcgggcttccggggcgacgggcacgccgcggcggccgacgcggcgcgggcgttcgtcgcc
gagctcgcggcgggcctgccggctccggcggcggcatga

DBGET integrated database retrieval system