KEGG   Phycisphaera mikurensis: PSMK_15840Help
Entry
PSMK_15840        CDS       T01800                                 

Gene name
trpC
Definition
putative indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
phm  Phycisphaera mikurensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSMK_15840 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSMK_15840 (trpC)
Enzymes [BR:phm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PSMK_15840 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1864747..1865577
Genome map
AA seq 276 aa AA seqDB search
MPSILDDIVQTKRAEVDQRSASVSLEEMKARALDTPRPRNFFKALTQPARRLKVIAEVKR
ASPSAGVLRDDFDAVQIAEAYHANGAAAISCLTDERYFQGRLEDLQRIKDAVPIPVLRKD
FLIDPWQLYESRAAGADAVLLIAECLREPEMIDLLILATELQMTTLVEVHDLESLIQVKP
HLGFPLPGYQLLGINNRDLREMTTDVAHTIDLLGEVPDKGILVSESGIREHADVAELLKN
GVYRVLVGESLMKQEDPGAALRELIHGDDGGESFNG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcatcctcgacgacatcgtgcagaccaagcgggcggaggtggaccaacgttcc
gcgtcggtgtcgctggaggagatgaaagcgcgggcgctggacacgccccggccgcggaac
ttcttcaaggcgctcacgcagccggcccgccggctgaaggtcatcgccgaggtcaagcgg
gcgtccccgtccgcgggtgtgctccgcgacgacttcgacgcggtccagatcgccgaggcg
taccacgccaacggggcggccgcgatctcctgcctcaccgacgaacgctacttccagggg
cggctggaggacctccagcggatcaaggacgccgtgccgatccccgtgctgcggaaggac
ttcctgatcgacccgtggcagctgtacgagagccgggccgccggcgccgacgcggtgctg
ctgatcgccgagtgcctccgcgagccggagatgatcgatctgctgatcctcgcgaccgag
ctgcagatgaccacgctcgtcgaggtccacgacctcgagtcgctcatccaagtcaagccg
cacctgggcttcccgctgccgggctaccagctcctggggatcaacaaccgcgacctgcgg
gagatgaccacggacgtcgcccacacgatcgacctgctcggcgaggtgcccgacaagggc
atcctggtgagcgagtcgggcatccgcgagcacgccgatgtcgccgagctgctcaagaac
ggcgtctaccgcgtgctcgttggggagagcctcatgaagcaggaggatccgggcgccgcc
ctccgcgagctgatccacggcgacgacggcggcgagagcttcaacggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system