KEGG   Phycisphaera mikurensis: PSMK_24580Help
Entry
PSMK_24580        CDS       T01800                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00900  Terpenoid backbone biosynthesis
phm01100  Metabolic pathways
phm01110  Biosynthesis of secondary metabolites
phm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSMK_24580 (dxr)
Enzymes [BR:phm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PSMK_24580 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: BAM04617
UniProt: I0IH79
Position
2925748..2926953
Genome map
AA seq 401 aa AA seqDB search
MSSGRDAPPPQPPGPTRTRRVVVLGATGSIGRNTLEVIAHLNGSSGGPRPFEVVALAAGS
DAAGLAGAAAAWPRARCSLASLGGDAPPGWLRGPGSAERLVREASADLVVAAVVGVAGLR
PVLAAIDAGADVALANKEVLVAAGELVMRRASRSGSRLLPVDSEHAGVLQCLAGHPRERV
RRVVLTASGGPFRDRTAVEVADATPDEAVAHPNWDMGPKISVDSATMMNKALELVEAHHL
FGLRADQLDAIIHPQSIVHAIVEYEDGGVLAQLGAADMRGPIQAALAWPDRPAGCGERLD
LLRLGGLTFRSADPHRFPALGLAQRVMAAGGTAGAVFNAANEAAVAAFLERRVPFGRIVG
LVSSALDALPPRPVARLEDVLDADAAARRFVGDAVGSPPAA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcggggcgggacgctcctccgccgcagcccccgggcccgacgcggacgcggcgg
gtcgtggtgctcggcgcgaccggctccatcggccgcaacaccctcgaggtcatcgcgcac
ctgaacggctccagcggcggcccgcggccgttcgaggtggttgccctcgccgccggttcc
gacgcggcgggcctcgccggtgccgcggcggcgtggccgcgggcgcggtgctcgctggcg
tcgctcggcggcgacgcgcctccgggctggctccgggggcccggctccgccgagcggctc
gtccgcgaagcgtctgccgacctggtcgtcgccgcggtggtcggcgtggccggcctgcgg
cccgtgctcgccgccatcgacgccggtgcggacgtggcgctggccaacaaggaggtgctc
gtcgccgccggcgagctggtgatgcggcgtgcctcgcggagcggttcgcggctgctcccg
gtggactccgagcacgcgggcgtgctgcagtgcctcgcggggcacccgcgtgagcgggtc
cgccgggtcgtgctgaccgcctcgggcgggccgttccgcgatcgcaccgccgtggaggtc
gccgacgcgacgcccgacgaggccgtagcgcacccgaactgggacatgggcccgaagatc
agcgtcgactccgcgacgatgatgaacaaggcgctggagctcgtcgaggcccatcacctc
ttcgggctccgggccgatcagctcgacgcgatcatccacccccagtcgatcgtgcacgcg
atcgtcgagtacgaagacgggggcgtcctcgcgcagctgggcgccgccgacatgcgcgga
ccgatccaggccgcgctcgcctggcccgaccgccccgccggctgcggcgaacgcctcgac
ctgctccgcctcggcgggctgaccttccgctcggccgacccccaccgcttccccgcgctg
ggcctcgcccagcgcgtcatggccgcgggcggcacggccggcgccgtcttcaacgccgcg
aacgaggccgccgtggccgccttcctcgaacggcgggtccccttcggccgtatcgtcggc
ctcgtctcctcggcgctcgacgcgctgccgccgcggcccgtggctcgtctcgaggacgtg
ctggacgccgatgcggccgcacgccgcttcgtcggcgacgcggtcggctccccgcccgcc
gcctga

DBGET integrated database retrieval system