KEGG   Phycisphaera mikurensis: PSMK_24640Help
Entry
PSMK_24640        CDS       T01800                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSMK_24640 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSMK_24640 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSMK_24640 (trpB)
Enzymes [BR:phm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSMK_24640 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2933094..2934335
Genome map
AA seq 413 aa AA seqDB search
MTATATPPISQTRRFPDDRGYFGGYGGVFIPETLHHAVAELAEAYREARADPAFAAQLAE
LARDYIGRPTPLQFAPRLTAAGGGAQIWLKREDLAHTGAHKINNAIGQCLLALRMGKKRI
IAETGAGQHGVATATAAAKFGLPCEVFMGEEDMRRQRPNVLRMRMMGATVTGVGDGSRTL
KDATNAALRDWMGSSADTHYIIGSVVGPHPFPMIVRDFQAVIGHESIAACRDQIGRLPDT
VVAVVGGGSNASGMFYPFASDPGCDGVALVGVEPGGTGTAPGQHAAALTHGSPGVLHGAL
SYVMQNSDGQTADVHSVSAGLDYPGIGPEHSCWKDSGRVSYASVTDSEALAAFELICRLE
GILPALEPSHALAHVMKLAPTLPADHVVLMNLCGRGDKDLDEVIRLLGHAETA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacggccacccccccgatctcgcagacccgccgcttccccgacgaccgcggg
tacttcggcggctacggcggcgtcttcatccccgagacgctgcaccacgcggtggccgag
ctcgccgaagcctaccgcgaagcgcgagcggacccggccttcgcggcgcagctcgccgag
ctcgcacgcgactacatcggccgcccgacgcccctgcagttcgctccgcgcctcaccgcc
gccggcggcggggcgcagatctggctgaagcgtgaagacctcgcccacacgggagcccac
aagatcaacaacgcgatcgggcagtgcttgctggcgctgcggatgggcaagaagcggatc
atcgcggagaccggcgccggccagcacggcgtcgcgaccgccaccgcggcggccaagttc
ggcctgccctgcgaggtcttcatgggcgaggaggacatgcgccgccagcggcccaacgtc
ctgcggatgcggatgatgggggccaccgtcaccggcgtcggcgacgggagccggacgctc
aaggacgccaccaacgcggcgctgcgggactggatgggcagctccgcggacacccactac
atcatcggcagcgtcgtgggtccgcaccccttcccgatgatcgtgcgcgacttccaggcc
gtgatcggccacgagagcatcgccgcctgccgcgaccagatcggccgcttgcccgacacc
gtggtcgccgtggtcggcggcggctccaacgcctcgggcatgttctacccgttcgcgagc
gatcccggctgcgacggcgtcgcgctcgtgggcgtcgaacccggcgggaccgggacggcg
ccgggccagcacgccgccgcgctcacccacggaagcccgggggtgctgcacggcgcgctc
tcgtacgtgatgcagaactccgacggccagaccgccgacgtccacagcgtctccgccggc
ctggactaccccggcatcgggcccgagcacagctgctggaaggacagcggccgcgtgagc
tacgcgagcgtcaccgacagcgaggcgctcgccgcgttcgagctgatctgcaggctcgag
ggcatcctgcccgcgctcgagccgtcgcacgcgctcgcccacgtgatgaagctcgccccg
acgctgcccgccgatcacgtcgtcctgatgaacctctgcggccgcggcgacaaggacctc
gacgaggtcatccgattgctgggccacgccgagaccgcgtga

DBGET integrated database retrieval system