KEGG   Phycisphaera mikurensis: PSMK_26170Help
Entry
PSMK_26170        CDS       T01800                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
phm  Phycisphaera mikurensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:phm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3125568..3126224
Genome map
AA seq 218 aa AA seqDB search
MSTRAPAAYQALLEQLAKLPGVGRRSAERIALHLLKKPDAESFALAAALRAFREELVVCS
VTGMVADADPCWIVTDPKRDHTRILVVEQPADVLAFEQSNAWNGSYHVLLGRLSPMEAVS
PGDLNIGLLLDRVRAGGRGPSGGTAGNDDGPRIRIEEVVLATSPSLEGDGTALYLEQELA
GLGVSVTRVARGLSAGQALDTASKAVLGDALHHRVPTR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgcgcccccgccgcctaccaggcgctcctggagcagctcgcgaagctgccc
ggggtgggtcgccgctccgcggagcggatcgcgctgcacctgctcaagaagcccgacgcg
gagagcttcgcgctcgccgcggcgttgcgggccttccgcgaggagctggtggtctgctcg
gtcaccggcatggtcgccgacgccgatccgtgctggatcgtgaccgatcccaagcgggat
cacaccaggatcctggtcgtcgagcagcccgccgacgtgctcgccttcgagcagagcaac
gcctggaacggcagctaccacgtgctgctcggccggctgtcgccgatggaggccgtcagc
cccggcgatctgaacatcggcctgctgctggaccgcgtgcgggcgggcggccgcggaccg
tcgggcggaacggccggaaacgacgacggtccgcggatccgcatcgaggaggtcgtgctc
gcgaccagcccgagcctcgagggcgacggcaccgcgctgtacctcgagcaggagctcgcc
ggcctcggcgtctccgtcacccgcgtcgcccgcggcctctccgccgggcaagcgctggac
accgcgagcaaggcggtgctcggcgacgcgctccaccaccgcgtcccgacgcgctga

DBGET integrated database retrieval system