KEGG   Phycisphaera mikurensis: PSMK_28350Help
Entry
PSMK_28350        CDS       T01800                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
phm  Phycisphaera mikurensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:phm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:phm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3376801..3378132
Genome map
AA seq 443 aa AA seqDB search
MDAFEITGGRPLRGEVTIQGAKNAALPLMAAALLAGGDTPVTLRNVPDLSDIRSMLKLLA
ELGLELTRDTGGTLSSAPSASDKVLAPYDIVKTMRAGICVLGPLLAKRGRAEVSMPGGCA
IGTRPVDLHLRGLEALGARITLDAGYIVAEAPPARGGGRRLRGAHVFLGGPNGSTVLGTA
NVMSAAVLAAGTTVIECAACEPEIEDLGKMLVGMGAEIEGLGSPRVTVHGVDELAGVDHA
VMPDRIEAGTYLAAAAATGGDVAIHRFPVRAMGAFLAALRDVGVRLEEVDGGSADRELND
AETATVRGVIPRRLDPTAVVTQPHPGFPTDLQAQLMALLCLADGNSLVTEKIFPDRFLHV
PELQRMGADVTRLGPSAMVRGVRELIGAPVMASDLRASAGLVIAGLAARGTTLVQRVYHL
DRGYEAMETRLQALGADIQRVRR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttcgagatcacggggggcaggccgctccggggcgaggtcaccatccagggg
gcgaagaacgcggcgctgccgctgatggccgcggcgctgctcgccggcggcgacacgccg
gtgacgctgcggaacgtgcccgacctctcggacatccgcagcatgctcaagctgctcgcg
gagctgggcctggagctgacgcgagacaccgggggcacgctgtcctcggccccgtcggcc
agcgacaaggtgctggcgccctacgacatcgtcaagacgatgcgggcgggcatctgcgtg
ctcggcccgctgctggcgaagcgggggcgggcggaggtctcgatgcccggcggctgcgcg
atcgggacgcggccggtcgacttgcacctccgcgggctcgaggcattgggcgcccgcatc
acgctcgacgccgggtacatcgtggccgaggcgccgccggcccgcggcggcgggcggcgc
ctccgcggggcccacgtcttcctcggcggccccaacggctcgacggtcctgggcacggcc
aacgtgatgtccgcggcggtgctcgccgcgggcacgaccgtcatcgagtgcgccgcctgc
gagcccgagatcgaagacctcgggaagatgctcgtcggcatgggggccgagatcgagggg
ctcggctcgccgcgcgtgaccgttcacggcgtcgacgagctcgccggcgtcgaccacgcc
gtgatgcccgatcggatcgaggcgggcacctacctggccgccgccgccgcgaccggcggc
gacgtggcgatccaccgcttcccggtgcgggcgatgggcgccttcctcgccgcgctccgg
gacgtgggcgtccggctggaggaggtcgacggcggatccgcggaccgcgaactcaacgac
gccgaaaccgccacggtccgcggggtcatcccgcgccggctcgatcccacggcggtcgtg
acccagccgcacccgggcttccccaccgacctgcaggcccagctgatggcgctgctctgc
ctcgccgacggcaactcgctggtgaccgagaagatcttccccgaccgcttcctgcacgtg
cccgagctgcaacgcatgggcgccgacgtcacgcggctggggccctcggcgatggtccgt
ggggtccgcgagctgatcggggcgccggtgatggccagcgacctgcgggcctccgccggc
ctggtcatcgccggcctcgccgcccggggcacgacgctcgtgcagcgcgtctaccacctc
gaccgcggctacgaggcgatggagacgcggctgcaggcgctgggcgccgacatccaacgc
gtccggcgctag

DBGET integrated database retrieval system