KEGG   Phycisphaera mikurensis: PSMK_28480Help
Entry
PSMK_28480        CDS       T01800                                 

Gene name
glk
Definition
putative glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSMK_28480 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSMK_28480 (glk)
   00052 Galactose metabolism
    PSMK_28480 (glk)
   00500 Starch and sucrose metabolism
    PSMK_28480 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSMK_28480 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSMK_28480 (glk)
   00524 Butirosin and neomycin biosynthesis
    PSMK_28480 (glk)
Enzymes [BR:phm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSMK_28480 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3391491..3392417)
Genome map
AA seq 308 aa AA seqDB search
MRLGLDVGGTKCAAVVGTAEGEVIERVQWPSAADRGPDSMIDRLVRAARGFMDRHAGVAS
VGVSIGGPLDAEAGVIHAPPNLPGWDAIPLRARLTDALGLPVRVMHDAAACALAEARWGV
GRGLDQPVTLAFLTCGTGMGAGLVLRGEAWVGAGGRSPELGHVRLTDGPDDPEAFGKRGC
VEAWCAGAGLPGVAAAAAPARWGPGGTQPAPAGPALSALAAAGDADALATLALHARMTGR
TAAILGDLLVPGAIVLGSLAPRLGERWIGQVRAAFAAEVLPAVADRCRVVPAALGDRLQD
LAALAAAG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctcgggctcgacgtgggcgggacgaagtgcgccgcggtggtgggcaccgccgag
ggtgaggtgatcgagcgggtccagtggccctccgccgcggaccgtggccccgattcgatg
atcgaccgcttggtccgcgccgcccgcgggttcatggatcggcacgcgggcgtggcgtcg
gtcggcgtctccatcggcgggccgctcgacgccgaggccggcgtcatccacgccccgccg
aatctgccgggctgggacgcgatcccgctgcgtgcccggctgaccgacgcgctgggcctt
cccgttcgcgtcatgcacgacgccgcggcctgtgccctggccgaggcgcggtggggcgtc
ggccgcggcctcgaccagccggtcacgctggccttcctgacctgcggcaccggcatgggg
gcggggctcgtgctccgcggcgaggcctgggtgggggccgggggccgctcgccggagctg
ggccacgtgcggcttacggacggccccgacgaccccgaagccttcggcaagcgcggctgc
gtggaggcctggtgcgcgggggccgggctgcccggcgtcgccgcggccgcggcgcccgcc
cgctgggggccgggcgggacgcagcccgccccggcgggcccggcgctctccgccctcgcc
gcggcgggcgatgccgacgccctcgccacgctcgccctgcacgcccgcatgaccggccgg
accgccgcgatcctcggcgacctgctcgtgcccggggcgatagtgctcggcagcctcgcc
ccccggctgggcgagcggtggatcggacaggtccgcgcagccttcgccgccgaggtgctg
cccgccgtcgccgaccgctgccgcgtcgttcccgccgccctcggcgaccgcctgcaggac
ctcgccgccctcgcggcggcggggtga

DBGET integrated database retrieval system