KEGG   Phycisphaera mikurensis: PSMK_29890Help
Entry
PSMK_29890        CDS       T01800                                 

Definition
hypothetical protein
Organism
phm  Phycisphaera mikurensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3537400..3539094)
Genome map
AA seq 564 aa AA seqDB search
MTLLRTLLGCPRLLAGGLIVAASAPDALAAETRIDLRRQAQTIRGFGVSMGGGNDANRIE
GRDRGESVMHNEDFYDHYVGDLGASVVRTGVSRTVLSKGGKYWPQHADLREPIRLGSDTY
ANIEAFDFTVKGVGNVGHFVRKAARRGDPMTLMGAIWSPPVWMKGPEVDLGYKDFAGQLP
RDTFWNASAAGSLVDTPDNLQQFGRYVAAYAKGFEKAWDRPFDVLSVQNEPRFSTWYDSS
VYTPELFAEAVGAVNAAFAEHNAANPDDPILTRVLGPDDLGLGGKGSNLANVSFSYIKEV
RHDGDPETAVDVYGMHGYNGGGRFADSDDRIESWKTFRNGRVRDDGYVNYEGVGEGVEFW
VTEHSGHRHRWTDPGDTYNGAMGLALEVHEAMVGVDAVGYLYWQHEDWAGRLNNFTLTSG
LDENQPKYAAFKHFAKHVRPGMRRVAADVLEDGQVDTSAVKISAYLDEAAGTLTYVLLNV
TKVTQAVRLASLAAGGELLEASWSADGAYHQAGHADAGGWLNLQGESIWSVVTTLGSLNA
VPEPGTGVAVFAGGALLLRRRRRA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgctcagaacgctgcttggttgcccacgcctgctcgccgggggcctgatcgtc
gccgcgtccgcgcccgacgcgctcgccgccgagacgcggatcgacctccgccggcaggcc
cagaccatccgcgggttcggcgtctcgatgggcgggggcaacgacgccaacagaatcgag
gggcgtgaccgcggcgagtcggtgatgcacaacgaggacttctacgaccactacgtcggc
gacctcggcgcgtcggtggtgaggacgggggtctcgcggaccgtcctgagcaagggcggg
aagtactggccgcagcacgcggacctgcgcgagccgatccgcctcgggagcgacacctac
gcgaacatcgaggccttcgacttcacggtgaagggggtgggcaacgtcggccacttcgtg
cggaaggccgcgcggcgtggcgaccccatgacgctgatgggcgcgatctggagcccgccg
gtctggatgaagggccccgaggtggacctgggctacaaggacttcgccggccagctgccg
cgggacaccttctggaacgcctcggcggcgggttcgctggtcgacacgcccgacaacctg
cagcagttcggccgctacgtggcggcgtacgcgaagggcttcgagaaagcctgggaccgg
cccttcgacgtgctctccgtgcagaacgagccgcgtttcagcacctggtacgacagcagc
gtctacacgcccgagctcttcgccgaggccgtgggcgcggtcaacgccgccttcgccgag
cacaacgcggcgaaccccgacgacccgatcctcacccgcgtgctcggccccgacgacctg
gggctcggcggcaagggctcgaacctcgcgaacgtcagcttcagctacatcaaggaggtc
cgccacgacggcgaccccgagaccgccgtggacgtgtacggcatgcacggctacaacggc
ggcggccgcttcgccgattccgacgaccgcatcgagagctggaagaccttccgcaacggc
cgggtgcgcgacgacggctacgtcaactacgagggcgtcggcgagggcgtggagttctgg
gtcaccgagcactcgggccaccggcaccgctggacggatcccggcgacacctacaacggg
gcgatgggcctcgcgttggaggtgcacgaggcgatggtcggcgtggacgcggtgggctac
ctctactggcagcacgaggactgggccggacgcctcaacaacttcacgctgacgtcgggt
ctcgacgagaaccagcccaagtacgccgccttcaagcacttcgcgaagcacgtccgcccc
ggcatgcgtcgcgtggcggccgacgtgctcgaggacgggcaggtggacacctcggccgtg
aagatctcggcgtacctcgacgaggcggccggcacgctcacgtacgtgctgctgaacgtg
acgaaggtgacgcaggcggtccgcctcgcctccctcgccgcgggcggcgagctgctggag
gcttcctggtcggccgacggcgcgtaccaccaggccgggcacgccgacgcgggcggctgg
ctgaacctgcagggcgagagcatctggagcgtggtgacgacgctgggcagcctgaacgcc
gtgcccgagccgggcaccggcgtcgccgtctttgccggcggggctctgctcctccgccgt
cgacgccgagcctga

DBGET integrated database retrieval system