KEGG   Phycisphaera mikurensis: PSMK_29890Help
Entry
PSMK_29890        CDS       T01800                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
phm  Phycisphaera mikurensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PSMK_29890
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PSMK_29890
Enzymes [BR:phm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PSMK_29890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3537400..3539094)
Genome map
AA seq 564 aa AA seqDB search
MTLLRTLLGCPRLLAGGLIVAASAPDALAAETRIDLRRQAQTIRGFGVSMGGGNDANRIE
GRDRGESVMHNEDFYDHYVGDLGASVVRTGVSRTVLSKGGKYWPQHADLREPIRLGSDTY
ANIEAFDFTVKGVGNVGHFVRKAARRGDPMTLMGAIWSPPVWMKGPEVDLGYKDFAGQLP
RDTFWNASAAGSLVDTPDNLQQFGRYVAAYAKGFEKAWDRPFDVLSVQNEPRFSTWYDSS
VYTPELFAEAVGAVNAAFAEHNAANPDDPILTRVLGPDDLGLGGKGSNLANVSFSYIKEV
RHDGDPETAVDVYGMHGYNGGGRFADSDDRIESWKTFRNGRVRDDGYVNYEGVGEGVEFW
VTEHSGHRHRWTDPGDTYNGAMGLALEVHEAMVGVDAVGYLYWQHEDWAGRLNNFTLTSG
LDENQPKYAAFKHFAKHVRPGMRRVAADVLEDGQVDTSAVKISAYLDEAAGTLTYVLLNV
TKVTQAVRLASLAAGGELLEASWSADGAYHQAGHADAGGWLNLQGESIWSVVTTLGSLNA
VPEPGTGVAVFAGGALLLRRRRRA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgctcagaacgctgcttggttgcccacgcctgctcgccgggggcctgatcgtc
gccgcgtccgcgcccgacgcgctcgccgccgagacgcggatcgacctccgccggcaggcc
cagaccatccgcgggttcggcgtctcgatgggcgggggcaacgacgccaacagaatcgag
gggcgtgaccgcggcgagtcggtgatgcacaacgaggacttctacgaccactacgtcggc
gacctcggcgcgtcggtggtgaggacgggggtctcgcggaccgtcctgagcaagggcggg
aagtactggccgcagcacgcggacctgcgcgagccgatccgcctcgggagcgacacctac
gcgaacatcgaggccttcgacttcacggtgaagggggtgggcaacgtcggccacttcgtg
cggaaggccgcgcggcgtggcgaccccatgacgctgatgggcgcgatctggagcccgccg
gtctggatgaagggccccgaggtggacctgggctacaaggacttcgccggccagctgccg
cgggacaccttctggaacgcctcggcggcgggttcgctggtcgacacgcccgacaacctg
cagcagttcggccgctacgtggcggcgtacgcgaagggcttcgagaaagcctgggaccgg
cccttcgacgtgctctccgtgcagaacgagccgcgtttcagcacctggtacgacagcagc
gtctacacgcccgagctcttcgccgaggccgtgggcgcggtcaacgccgccttcgccgag
cacaacgcggcgaaccccgacgacccgatcctcacccgcgtgctcggccccgacgacctg
gggctcggcggcaagggctcgaacctcgcgaacgtcagcttcagctacatcaaggaggtc
cgccacgacggcgaccccgagaccgccgtggacgtgtacggcatgcacggctacaacggc
ggcggccgcttcgccgattccgacgaccgcatcgagagctggaagaccttccgcaacggc
cgggtgcgcgacgacggctacgtcaactacgagggcgtcggcgagggcgtggagttctgg
gtcaccgagcactcgggccaccggcaccgctggacggatcccggcgacacctacaacggg
gcgatgggcctcgcgttggaggtgcacgaggcgatggtcggcgtggacgcggtgggctac
ctctactggcagcacgaggactgggccggacgcctcaacaacttcacgctgacgtcgggt
ctcgacgagaaccagcccaagtacgccgccttcaagcacttcgcgaagcacgtccgcccc
ggcatgcgtcgcgtggcggccgacgtgctcgaggacgggcaggtggacacctcggccgtg
aagatctcggcgtacctcgacgaggcggccggcacgctcacgtacgtgctgctgaacgtg
acgaaggtgacgcaggcggtccgcctcgcctccctcgccgcgggcggcgagctgctggag
gcttcctggtcggccgacggcgcgtaccaccaggccgggcacgccgacgcgggcggctgg
ctgaacctgcagggcgagagcatctggagcgtggtgacgacgctgggcagcctgaacgcc
gtgcccgagccgggcaccggcgtcgccgtctttgccggcggggctctgctcctccgccgt
cgacgccgagcctga

DBGET integrated database retrieval system