KEGG   Phycisphaera mikurensis: PSMK_30480Help
Entry
PSMK_30480        CDS       T01800                                 

Definition
putative pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
phm  Phycisphaera mikurensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PSMK_30480
Enzymes [BR:phm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PSMK_30480
    3.5.1.-  
     PSMK_30480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3610385..3610759
Genome map
AA seq 124 aa AA seqDB search
MGASLLIDIQNDFLPGGSLAVPDGDAVIPVANRLMPAYRLVVATEDWHPAGHGSFARSHA
GKRPGEVIEPTGQDQVLWPDPCVQGTPGAELHDDLDRGGVDEGDGCDDLLNGPGATPLGG
WRSR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgggagcttcgctcctgatcgacatccagaatgacttcctccccggcgggagcctggcg
gttcctgatggtgacgcggtgatcccggtggcgaaccggctgatgccggcgtaccggctc
gtcgtcgcgacggaggactggcacccggcggggcacgggagcttcgcgagaagccacgcc
gggaagaggccgggcgaggtgatcgagccgaccgggcaggaccaggtgctctggccggac
ccttgcgtgcagggcacgccgggggcggagcttcacgacgacctcgatcgcggcggcgtc
gacgagggcgacgggtgtgacgatctgctgaacggaccgggtgccacgcccctcgggggg
tggcgttctcgatga

DBGET integrated database retrieval system