KEGG   Phycisphaera mikurensis: PSMK_31640Help
Entry
PSMK_31640        CDS       T01800                                 

Gene name
sucB
Definition
(RefSeq) putative 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
phm  Phycisphaera mikurensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSMK_31640 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSMK_31640 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSMK_31640 (sucB)
Enzymes [BR:phm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSMK_31640 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3759566..3760888)
Genome map
AA seq 440 aa AA seqDB search
MAIDLIVPEVGESITEVQIGRWLKKEGESVAKDEPLVEIETDKVTVELPAPEAGVLGKVL
KAEGDEAAVGDKIGELGEGDGSAATDPDAIPQPTDPADRKAGGAGGGDGKPATGDDQYRA
SGDDDASPKASPTGADTVVMPAARRLLDESGLDLGQVTATGPGGRVLKEDVQKAIDSGAK
PGAKSDGKPEPKAQPAKAEPADGGSGETVKPMTPLRRTIASSLVKAQQTAALLTTFNEVD
MTEVMSLRSRHKELFQETHGAKLGFMSFFVKATVEALKRFPAVNAEVRGTDVVYKDRYDV
GIAIGGGKGLVVPVLRDCAAMSFAQIESQIVTYAKAAQANKLKLDQLTGGSFTITNGGVY
GSLLSTPIVNPPQSGVLGMHGIVRRPIAVGKGADERVEIRPMMYLALTYDHRVVDGREAV
TFLNVVKNAIEDPARMLLEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccattgatctcatcgttcccgaagtcggcgagtccatcaccgaggtccagatcggc
cgctggctgaagaaggagggcgagtcggtcgccaaggacgagccgctcgtggagatcgag
accgacaaggtgacggtcgagctgccggcccccgaggccggcgtgctgggcaaggtcctc
aaggccgagggcgacgaggccgcggtgggcgacaagatcggcgagctgggggagggcgac
ggctcggcggcgaccgaccccgacgcgatccctcagccgaccgacccggccgaccgcaag
gcgggcggagcgggcggcggcgacggcaagccggccaccggcgacgaccagtaccgcgcc
agcggggacgacgacgcctcgccgaaggcgtcgcccaccggcgccgacaccgtcgtcatg
cccgcggcccgccgcctgctcgacgagagcggcctggacctcggccaggtcaccgccacc
ggccccggcggccgcgtcctcaaggaggacgtgcagaaggcgatcgactcgggcgcgaag
ccgggggcgaagagcgacgggaagccggagccgaaggcccaaccggcaaaggccgagccc
gccgacgggggttcgggggagacggtcaagccgatgacgccgctgcgtcgcaccatcgcg
tcgagcctcgtgaaggcccagcagaccgccgcgctgctcaccaccttcaacgaggtggac
atgaccgaggtgatgtcgctccgctcccgccacaaggagctcttccaggagacgcacggc
gcgaagctcggcttcatgtccttcttcgtgaaggcgacggtggaggcgctcaagcgcttc
cccgccgtgaacgcggaggtccgcgggaccgacgtcgtctacaaggaccgctacgacgtg
ggcatcgccatcggcggcggcaagggcctcgtggtgcctgtgctccgcgactgcgcggcc
atgagcttcgcgcagatcgagtcgcagatcgtcacctacgccaaggcggcgcaggcgaac
aagctcaagctcgatcagctcaccggcggcagcttcacgatcaccaacggcggcgtgtac
ggctctttgctctccacgcccatcgtgaacccgccgcagagcggcgtgctcggcatgcac
ggcatcgtccgccgcccgatcgcggtgggcaagggagccgacgagcgggtcgagatccgg
ccgatgatgtacctcgcgctcacctacgaccaccgcgtcgtcgacggccgcgaggcggtg
accttcctcaacgtcgtcaagaacgcgatcgaggaccccgcccgcatgctgctggagctc
tga

DBGET integrated database retrieval system