KEGG   Phycisphaera mikurensis: PSMK_31710Help
Entry
PSMK_31710        CDS       T01800                                 

Definition
6-phosphofructokinase (EC:2.7.1.-)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSMK_31710
   01230 Biosynthesis of amino acids
    PSMK_31710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSMK_31710
   00030 Pentose phosphate pathway
    PSMK_31710
   00051 Fructose and mannose metabolism
    PSMK_31710
   00052 Galactose metabolism
    PSMK_31710
  Energy metabolism
   00680 Methane metabolism
    PSMK_31710
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PSMK_31710
Enzymes [BR:phm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PSMK_31710
Protein phosphatases and associated proteins [BR:phm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PSMK_31710
Messenger RNA biogenesis [BR:phm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PSMK_31710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3769547..3770740)
Genome map
AA seq 397 aa AA seqDB search
MNAVVGQSGGPTAVINQSLAGVVETLQQRSDFTGKILGARHAVAGVVRGDFADLTGIDAE
KLDLIAGTPSSALGSSRDKPDAAYCERIFESFTKHDVGYFFYAGGNDSSDTCRIVAEMAG
AKGYDLKAFHVPKTIDNDLKVNDHTPGFGSAAKFVAQAFMGDDLDNRALPGIKINVVMGR
HAGFLTAASLAGVVAEDSGPHLVCVPEVTFDEEKFIDDVERVYKKLGRCLVAVSEGIHDA
DGNAIITKLQEDVEKDAHGNVQLSGTGALGDLLADLVKKKLGDRLGQKLRVRADTFGYLQ
RSFVGCVSEVDAAEARQAGREAVKAAFESGRGSGSIAIVRTSSSPYAVDYKTIDIAEVAA
LTRHMPEAFLGGERGVTEAFVDYVKPIIGELPAVGLL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcgtcggacaatccggaggccccacggccgtcatcaaccagtcgctcgcg
ggcgtcgtcgagacgctgcagcagcggagcgacttcacgggcaagatcctcggcgcccgc
cacgcggtcgccggcgtggtccggggcgacttcgcggacctcaccggcatcgacgcggag
aagctggacctcatcgccggcacgccctcctcggcgctgggcagctcgcgcgacaagccc
gacgcggcctactgcgagcggatcttcgagagcttcacgaagcacgacgtcggctacttc
ttctacgccggcggcaacgacagctcggacacctgccgcatcgtcgccgagatggcggga
gccaagggctacgacctcaaggccttccacgtccccaagacgatcgacaacgacctgaag
gtcaacgaccacacccccggcttcggctccgcggccaagttcgtcgcgcaggccttcatg
ggcgacgacctggacaaccgggcgttgccgggcatcaagatcaacgtggtcatgggccgc
cacgccggcttcctcaccgccgcttccctggccggcgtcgtcgccgaggacagcgggccg
cacctggtgtgcgtgccggaggtgaccttcgacgaggagaaattcatcgacgacgtcgag
cgcgtctacaagaagctcggccgctgcctcgtcgccgtgagcgagggcatccacgacgcc
gacggcaacgccatcatcaccaagctccaggaggacgtggagaaggacgcccacggcaac
gtgcagctctccggcacgggcgccctgggcgacctcctcgcggacctcgtgaagaagaag
ctcggcgaccggctcgggcagaagctccgcgtgcgggccgacaccttcggctacctgcag
cgcagcttcgtgggctgcgtgagcgaggtcgacgcggcggaggcccggcaggccggccgc
gaagcggtgaaggcggccttcgagagcggccgcggatcgggctcgatcgcgatcgtccgc
acctcctcctcgccctacgccgtcgactacaagacgatcgacatcgccgaggtcgcggcg
ctgacccgccacatgcccgaggcgttcctcggcggcgagcggggcgtgacggaggcgttc
gtcgactacgtgaagccgatcatcggggagctgccggcggtcgggctcctctga

DBGET integrated database retrieval system