KEGG   Phycisphaera mikurensis: PSMK_31710Help
Entry
PSMK_31710        CDS       T01800                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
phm  Phycisphaera mikurensis
Pathway
phm00010  Glycolysis / Gluconeogenesis
phm00030  Pentose phosphate pathway
phm00051  Fructose and mannose metabolism
phm00052  Galactose metabolism
phm00680  Methane metabolism
phm01100  Metabolic pathways
phm01110  Biosynthesis of secondary metabolites
phm01120  Microbial metabolism in diverse environments
phm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSMK_31710
   00030 Pentose phosphate pathway
    PSMK_31710
   00051 Fructose and mannose metabolism
    PSMK_31710
   00052 Galactose metabolism
    PSMK_31710
  Energy metabolism
   00680 Methane metabolism
    PSMK_31710
Enzymes [BR:phm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PSMK_31710
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PSMK_31710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: BAM05330
UniProt: I0IJ92
Position
complement(3769547..3770740)
Genome map
AA seq 397 aa AA seqDB search
MNAVVGQSGGPTAVINQSLAGVVETLQQRSDFTGKILGARHAVAGVVRGDFADLTGIDAE
KLDLIAGTPSSALGSSRDKPDAAYCERIFESFTKHDVGYFFYAGGNDSSDTCRIVAEMAG
AKGYDLKAFHVPKTIDNDLKVNDHTPGFGSAAKFVAQAFMGDDLDNRALPGIKINVVMGR
HAGFLTAASLAGVVAEDSGPHLVCVPEVTFDEEKFIDDVERVYKKLGRCLVAVSEGIHDA
DGNAIITKLQEDVEKDAHGNVQLSGTGALGDLLADLVKKKLGDRLGQKLRVRADTFGYLQ
RSFVGCVSEVDAAEARQAGREAVKAAFESGRGSGSIAIVRTSSSPYAVDYKTIDIAEVAA
LTRHMPEAFLGGERGVTEAFVDYVKPIIGELPAVGLL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtcgtcggacaatccggaggccccacggccgtcatcaaccagtcgctcgcg
ggcgtcgtcgagacgctgcagcagcggagcgacttcacgggcaagatcctcggcgcccgc
cacgcggtcgccggcgtggtccggggcgacttcgcggacctcaccggcatcgacgcggag
aagctggacctcatcgccggcacgccctcctcggcgctgggcagctcgcgcgacaagccc
gacgcggcctactgcgagcggatcttcgagagcttcacgaagcacgacgtcggctacttc
ttctacgccggcggcaacgacagctcggacacctgccgcatcgtcgccgagatggcggga
gccaagggctacgacctcaaggccttccacgtccccaagacgatcgacaacgacctgaag
gtcaacgaccacacccccggcttcggctccgcggccaagttcgtcgcgcaggccttcatg
ggcgacgacctggacaaccgggcgttgccgggcatcaagatcaacgtggtcatgggccgc
cacgccggcttcctcaccgccgcttccctggccggcgtcgtcgccgaggacagcgggccg
cacctggtgtgcgtgccggaggtgaccttcgacgaggagaaattcatcgacgacgtcgag
cgcgtctacaagaagctcggccgctgcctcgtcgccgtgagcgagggcatccacgacgcc
gacggcaacgccatcatcaccaagctccaggaggacgtggagaaggacgcccacggcaac
gtgcagctctccggcacgggcgccctgggcgacctcctcgcggacctcgtgaagaagaag
ctcggcgaccggctcgggcagaagctccgcgtgcgggccgacaccttcggctacctgcag
cgcagcttcgtgggctgcgtgagcgaggtcgacgcggcggaggcccggcaggccggccgc
gaagcggtgaaggcggccttcgagagcggccgcggatcgggctcgatcgcgatcgtccgc
acctcctcctcgccctacgccgtcgactacaagacgatcgacatcgccgaggtcgcggcg
ctgacccgccacatgcccgaggcgttcctcggcggcgagcggggcgtgacggaggcgttc
gtcgactacgtgaagccgatcatcggggagctgccggcggtcgggctcctctga

DBGET integrated database retrieval system