KEGG   Phycisphaera mikurensis: PSMK_31740Help
Entry
PSMK_31740        CDS       T01800                                 

Definition
putative aldose 1-epimerase (EC:5.1.3.-)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
phm  Phycisphaera mikurensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSMK_31740
Enzymes [BR:phm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSMK_31740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3773242..3774072
Genome map
AA seq 276 aa AA seqDB search
MSFTPPDPAATPRAPGEISAGTDGATGRVTPYGAHVFSWIPAGHDEVLYVSPRAVLDGSK
PIRGGIPVCFPWFGAGGSGDATPAHGTVRRDTWEVRERRGDGAAFATRAGGFGISLDASF
GDTLTLRVAVTRTADDAAAFELALHSYFAVSEASAVSVTGLAGARGLDSLTGETFEQDTE
PIRFAAEYDRVFTGCPGPQTLHDPGLKRKIVITPDNLPSAIVWNPHAAKAGRMSDLGADQ
YPRFVCIESGRVRQDAVTLRPGETFEASVGIAVEAA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaccccccccgacccggcggccacgccccgggcacccggcgagatctccgcc
ggcaccgacggcgccaccggccgcgtgaccccctacggcgcgcacgtgttctcgtggatc
cccgccgggcacgacgaggtgctgtacgtctcaccgcgggcggtcctggatggcagcaag
ccgatccgcggcggcatcccggtgtgcttcccgtggttcggcgccggcgggtccggcgac
gccacgcccgcccacggcaccgtgcgccgcgacacctgggaggtgagggaacgccgcggc
gacggcgcggccttcgcgacgcgggcgggcggcttcggcatctcgctggacgcgagcttc
ggcgacacgctgacgctccgcgtcgccgtcacccgcacggccgacgacgccgcggccttc
gaactcgccctgcacagctacttcgcggtctccgaggcctcggcggtgtcggtcaccggc
ctcgccggcgcccgcggcctcgacagcctcaccggcgagaccttcgagcaggacaccgag
cccatccgcttcgccgccgaatacgaccgcgtcttcaccggctgccccggcccgcagacg
ctgcacgatccgggcctgaagcggaagatcgtcatcaccccggacaacctgccctcagcg
atcgtgtggaacccccacgccgcgaaggccggccgcatgagcgacctcggcgccgaccag
tacccgcgtttcgtctgcatcgagagcggacgcgtgcggcaggacgcggtcacgctgcgg
cccggcgaaaccttcgaagcgtccgtcgggatcgcggtcgaggcggcctga

DBGET integrated database retrieval system