KEGG   Pyrococcus horikoshii: PH0083Help
Entry
PH0083            CDS       T00014                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pho  Pyrococcus horikoshii
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pho00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
69041..69892
Genome map
AA seq 283 aa AA seqDB search
MLLYTYRSFDMELPTVDIKDADYIILGLPFDGTTSYKPGARFGPVLIRQATLNLESYILD
YDIDIAELKIADAGDVALPVSIEDAIKVAVETIKEVRSINPRALPIFLGGEHSMTYPPVK
VLEPKSYVVFDAHLDLRDSYQGSRFNHACVARRIHEMGVKVAIFGVRSGTREEVMFASQS
GIEWVHARDYNFDAFVDLVSSLPEPVYVSIDVDVFDLPLVPETGTPEPGGLGFWEVIEAL
EWLTKRKKVAGFDIMEVSGDRLGNSTSITAAKLLFYVIGMSAR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgctactttacacgtatcgctcattcgacatggaactcccaacggtggatatcaaagat
gctgactacataatcctgggattaccatttgatggtaccacaagctataaaccaggagca
agattcgggccagtactaattaggcaggctaccctaaatcttgaaagttacatcttagat
tatgatattgacattgcagaattgaaaattgccgatgcgggggatgtagcactaccggtg
agcatagaagatgcgataaaggtagcagttgaaaccattaaagaagttagaagtattaac
cctagagcactaccaatcttcctgggaggagagcattcaatgacttacccaccagttaaa
gtcctcgaacctaaaagctacgttgttttcgatgctcatctagacttaagggattcctat
caagggtcgaggtttaatcatgcatgcgttgcgaggagaatacacgaaatgggggtaaag
gttgcaatatttggggttaggagtggaactagagaagaggtcatgtttgcaagtcagagt
ggaatagaatgggttcacgctagggattacaattttgacgcattcgttgatttagtttca
tctcttcccgaaccggtttacgtttccatagatgtggatgtctttgatcttcccttagtt
ccagaaactggaacgccggaacctggagggcttggattctgggaggtcatagaggcccta
gaatggctcaccaaaagaaagaaggtagcaggtttcgatataatggaagtatctggagat
agattgggaaactcaacctcgataaccgcggctaagctcctcttctatgtaataggtatg
agtgctaggtga

DBGET integrated database retrieval system