KEGG   Pyrococcus horikoshii: PH0297Help
Entry
PH0297            CDS       T00014                                 

Gene name
alaS
Definition
alanyl-tRNA synthetase (EC:6.1.1.7)
Orthology
K01872  
alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
pho  Pyrococcus horikoshii
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pho00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    PH0297 (alaS)
Enzymes [BR:pho01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     PH0297 (alaS)
Amino acid related enzymes [BR:pho01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   PH0297 (alaS)
Transfer RNA biogenesis [BR:pho03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PH0297 (alaS)
 Prokaryotic Type
    PH0297 (alaS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
263038..265785
Genome map
AA seq 915 aa AA seqDB search
MEFIMKTRMFEEEGWIRKKCKVCGKPFWTLDPDRETCGDPPCDEYQFIGKPGIPRKYTLD
EMREKFLRFFEKHEIYPHGRVKRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPL
VISQPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWMDETVELAFEFFTKELKM
KPEDITFKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKKAPENAPQDQVVVIKGEKYI
PMETKVVDTGYGLERLVWMSQGTPTAYDAVLGYVVEPLKKMAGIEKIDEKILMENSRLAG
MFDIEDLGDLRYLREQVAKRVGITVEELEKAIRPYELIYAIADHTKALTFMLADGVVPSN
VKAGYLARLLIRKSIRHLRELGLEVPLSEIVALHIKELHKTFPEFKEMEDIILEMIELEE
KKYAETLRRGSDLVRREIAKLKKKGIKEIPVEKLVTFYESHGLTPEIVKEIAEKEGVKVN
IPDNFYSMVAKEAERTKEEKGEELVDFELLKDLPDTRRLYYEDPFMKEFDAKVLRVIKDW
VILDATAFYPEGGGQPYDTGVLIVNGREVKVTNVQKVGKVIIHKVEDPGAFKEGMIVHGK
IDWKRRIQHMRHHTGTHVLMGALVRVLGRHVWQAGSQLTTDWARLDISHYKRISEEELKE
IEMLANRIVMEDRKVTWEWLPRTTAEQKYGFRLYQGGVVPGREIRVVKIEDWDVQACGGT
HLPSTGLVGPIKILRTERIQDGVERIIFACGEAAIREWQKERDLLKKASNVLRVPPEKLP
ETAERFFNEWKEARKEVDKLKKELARLLVYELESKMQKIGSIEFIGEVVEGSMEDLRELV
EKLKKPKRVVVLISRDGYFAVSVGSEVGVEANELAKKITLIAGGGGGGRRDIAQGKVKDI
SKAKDVIESIKSMFS
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggagttcataatgaagacaagaatgttcgaggaagaggggtggataaggaagaagtgt
aaggtctgcggtaagcccttctggactcttgatcctgatagggaaacctgtggagaccct
ccatgtgacgagtatcagttcatcggaaagccaggaatacccaggaaatacaccttagat
gagatgcgtgagaagttccttagattctttgagaagcatgagatttatcctcatggtagg
gtgaagaggtatccagtccttcccaggtggagagatgacgttcttttagtgggagcttct
ataatggatttccagccctgggtaataagtggtgaagccgatcccccagctaatccacta
gtgatatcccagccttctataaggttcacggatatagacaacgtaggaataactggaaga
catttcactattttcgagatgatggctcatcatgccttcaactatccaggaaagccgata
tactggatggatgaaaccgttgagctagcctttgagttcttcacaaaggagttgaagatg
aagcctgaggatataaccttcaaggagaacccctgggctggtggaggaaatgctgggccc
gcattcgaagtactctatagaggtttagaggttgcaaccttggtattcatgcagtacaag
aaggccccggagaacgctccccaggatcaggtggttgttataaagggggagaagtatatt
cctatggaaacgaaggttgtagatacgggatatggccttgaaagactcgtttggatgagc
caaggaaccccaactgcgtacgatgcagtcttaggttatgtagttgagccgttgaagaag
atggccggtattgagaagatagatgaaaagatcctcatggagaactcacgcttagctgga
atgttcgatatagaagatctgggagacttacgctacttaagggagcaagttgctaagagg
gttggaataactgtcgaggaacttgagaaggccataaggccctatgagcttatatatgca
atagcggatcacacgaaagcattaaccttcatgttagctgatggtgttgttccctctaac
gtaaaggctgggtacttagcaagactccttataaggaagagtataaggcatttaagagag
ttagggcttgaagttcctttaagtgagatagtcgctttgcatattaaagaacttcacaag
acgttccccgagtttaaggagatggaggatattattcttgagatgatcgaacttgaagag
aagaagtatgcggagacgcttagaaggggtagtgaccttgtaaggagggagattgcgaag
ctgaagaagaagggtataaaggagatacccgtggaaaagcttgtaaccttctatgagagt
catggcctaacgcctgagatagtcaaggagatcgctgaaaaagagggggttaaggtaaac
atccccgacaatttctacagcatggtggctaaagaagctgaaagaactaaggaagagaag
ggagaagaactagttgattttgagctacttaaggatctaccagacacgaggagactttat
tatgaggatccctttatgaaagagtttgatgccaaggttcttagggtaattaaggattgg
gttatcctagatgccacggcattctatccggagggtggagggcaaccctacgatacgggt
gtcttaatcgttaatggaagggaagtcaaggtcacgaacgttcagaaggttgggaaggtt
ataatccacaaggttgaggatccaggggcgtttaaggagggaatgatagttcacgggaag
atagattggaagagaaggattcagcacatgaggcaccatactggaactcacgttctcatg
ggggccttggtcagagttctggggaggcacgtgtggcaagcaggttcacaactcactacc
gattgggcgagattggatataagccattacaagagaattagtgaagaggaacttaaggaa
attgagatgctggctaataggatagtcatggaggacagaaaggtgacgtgggagtggttg
ccaagaactacagcagagcagaagtatggctttagactttaccagggtggagtagttcct
gggagggagattagggttgtaaaaatagaggattgggatgtccaagcttgcggtggaact
cacctaccgagcacaggcttggttggtccgattaaaatacttaggactgagagaatacag
gatggagttgagaggataatattcgcttgcggtgaagctgcgataagagagtggcagaag
gaaagggatctgttaaagaaagctagtaacgttttaagggttcccccagagaagcttcca
gaaacagctgagagatttttcaatgaatggaaagaggcaagaaaggaagtagataagctt
aagaaggagctagctaggctcttagtttacgagcttgagtctaaaatgcaaaagatcggg
agtatagaattcataggggaagtagttgagggaagcatggaagatttgagggaactcgtt
gagaagcttaagaaaccgaaaagggttgttgttttaatatcgagggatggctacttcgcg
gtttccgtggggagcgaggttggtgttgaagccaacgagttagccaagaagataacatta
atagccggcggaggaggtggaggaagaagggatattgcccagggtaaagtaaaggatatc
agcaaggcaaaagatgttattgagagcattaaatctatgttctcttag

DBGET integrated database retrieval system