KEGG   Pyrococcus horikoshii: PH0416Help
Entry
PH0416            CDS       T00014                                 

Gene name
PH0416
Definition
(GenBank) 188aa long hypothetical dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00521  Streptomycin biosynthesis
pho00523  Polyketide sugar unit biosynthesis
pho01130  Biosynthesis of antibiotics
Module
pho_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PH0416 (PH0416)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PH0416 (PH0416)
Enzymes [BR:pho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PH0416 (PH0416)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: BAA29502
UniProt: O58153
Position
378735..379301
Genome map
AA seq 188 aa AA seqDB search
MVKMPFEFKRLEIPDVVLIKPKVFEDERGFFMETYKKSDFEKAGIKGEFVQDNHSKSKYG
VLRGLHFQRGSYAQAKIVRCIRGVIYDVAVDLRRNSPTFGKYVGVILSEYNKYQLYIPRG
FAHGFVVLSDVAEVVYKVDNVYAPDYEGGLIWNDPDVGIKWPIEDPILSEKDKKWPTLRE
LIERGWVF
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaagatgccctttgagttcaagaggcttgaaattcccgatgtggtcttgataaag
ccaaaggtttttgaagatgaaaggggtttctttatggagacctacaaaaaatccgacttc
gaaaaggcgggaattaagggtgagtttgtgcaggataatcattctaagtctaaatacggt
gtccttaggggcttgcactttcagaggggatcctatgcccaagccaagatagttagatgt
ataaggggagttatatatgatgttgcagtggacttgaggagaaactcgccaacgtttggg
aagtacgttggagtaattttgtccgaatacaacaagtaccagctctacattccgaggggg
ttcgcccacggatttgtagttttaagtgatgtcgccgaggttgtatacaaggtggacaac
gtatatgccccggattatgaaggtggtttgatatggaacgatcctgacgttggaattaag
tggccaattgaagatccaattctctcggagaaggataagaagtggcccactttgagggag
ctaatagagagaggatgggtgttctag

DBGET integrated database retrieval system