KEGG   Pyrococcus horikoshii: PH0483Help
Entry
PH0483            CDS       T00014                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pho  Pyrococcus horikoshii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pho00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PH0483
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PH0483
Enzymes [BR:pho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PH0483
Two-component system [BR:pho02022]
 CheA family
  CheA-CheYBV
   PH0483
Bacterial motility proteins [BR:pho02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PH0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
439744..440850
Genome map
AA seq 368 aa AA seqDB search
MPLMGRKIKVLVVDDSAFMRKVLKDIINSDPELEVCGEARDGIEAIEMVQKCRPDVVTLD
VEMPRMNGLDALRVIMKRYPVPVIMISALTQEGADATIKALEYGAIDFIPKPSSSISINM
KELKDEIIAKIKEAAKVPRRFLELRRIRLLRVQKAKKVKPSVPARIAVAIAASTGGPQSL
LKIFPKFPEDLKAGILLVQHMPPGFTRSFAKRLDSVSKIDVKEAEEGDVVEEGKAYVAPG
DYHMEVTLRAGKPVITLNKKPKIHGVRPAADPMMITAAQVFGRRTVGVVMTGMGRDGAQG
IVEIKKKGGITIAQDEKTSIIFGMPKAAIETGMVDYVVPLEKIPETVVKAVEIIRGGGNL
GRHVTISR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgccccttatggggagaaagattaaggttctcgtcgttgatgattcagccttcatgagg
aaggtgcttaaggatattataaactctgatccggagctggaagtttgtggggaagctagg
gatggcattgaagcaattgagatggttcaaaagtgtagacctgatgttgtaacgttagat
gttgaaatgcctcgaatgaatgggttagatgccttgagggtgataatgaaaaggtatccg
gttcccgttatcatgataagtgccctcacccaggaaggggctgacgctactataaaagct
cttgaatatggagcaattgactttattccaaaaccttcctcatcaatctcaattaatatg
aaggagttgaaggatgaaatcatagccaagataaaggaagctgcaaaagttcctaggaga
ttccttgagcttaggagaataaggttacttagggttcagaaagccaagaaggtaaagcct
tctgttccagctaggattgcagttgcgatagccgcttcaactggaggcccccagtcgttg
cttaagatattcccaaagttcccagaggatttaaaggctggtatattgctcgtccagcat
atgcctcccggcttcacaaggtcttttgcaaagagacttgatagtgtctccaagattgat
gtgaaggaagccgaggaaggagatgttgttgaggaggggaaagcttacgttgcccctgga
gattaccatatggaagttacactccgagctggtaaaccggtgattacgctaaacaaaaag
ccaaaaattcatggtgtgaggcctgcagcagatccaatgatgataaccgctgctcaggtc
ttcggtaggagaacagtaggagttgtcatgactggtatgggaagggatggagctcagggg
attgtagaaataaagaagaagggtggaataactatagctcaagatgagaagacgtcaata
atctttggaatgccaaaagctgctatagagacaggaatggtagattacgtcgttccccta
gagaagatacctgagacagttgttaaagcggtagaaattatcaggggaggtggtaacctt
ggaagacatgtcacaatatctagatga

DBGET integrated database retrieval system