KEGG   Pyrococcus horikoshii: PH0501Help
Entry
PH0501            CDS       T00014                                 

Definition
beta-mannosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pho  Pyrococcus horikoshii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pho00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pho00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(452907..454358)
Genome map
AA seq 483 aa AA seqDB search
MKFYWGVVQSAFQFEMGDPYRRNIDPRSDWWYWVRDPYNIKNDLVSGDLPEEGINNYELY
EIDHRLAKELGLNAYQLTIEWSRIFPCPTFNVEVEFERDGYGLIKKVKIEKEHLEELDKL
ANQKEVRHYLNVLRNLKKLGFTTFVTLNHQTNPIWIHDPIETRGNFQKARARGWVDERTI
IEFAKYAAYVAWKFDNYVDYWSTFDEPMVTAELGYLAPYVGWPPGILNPSAAKKVIINQI
VAHARAYDSIKKFSSKPVGVILNIIPAYPLDPNDSKSVRAAENYDLFHNRLFLEAVNRGN
VDLDITGEYTKIPHIKRNDWIGNNYYTREVVKYVEPKYEELPLITFVGVEGYGYSGNPNS
LSPDNNPTSDFGWEVFPQGLYDSTLEAAEYNKEVFITENGIADSKDILRPRYIIDHVNEV
KKLIENGIKVGGYFHWALTDNYEWAMGFKIRFGLYEVDLITKERIPRRRSVEIYKKIVME
GIE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttactggggcgtcgttcagtctgcatttcaatttgaaatgggggatccctac
aggaggaacatagatcccagaagcgattggtggtattgggtcagagatccatataacata
aagaatgacctcgtcagtggagacctaccagaagagggaataaataactatgaactttat
gaaatagatcataggttagcaaaagagcttggattgaatgcttatcaattaacgatagag
tggagcagaatattcccttgccccaccttcaatgtagaggttgaatttgaaagagacggg
tacgggctcataaaaaaggtgaaaatagaaaaggaacacttagaggagctcgataagctt
gcaaatcaaaaggaagttaggcattacctgaatgttttaaggaatttgaaaaaacttgga
tttacaacattcgtcactttgaaccaccagacaaatcccatatggatccatgaccccata
gaaactagggggaacttccaaaaggctagagcaagaggatgggttgacgaaaggacaatc
atagaattcgcgaagtatgcagcctatgtagcctggaagttcgacaactatgtagattac
tggtcaacatttgatgaaccaatggttacagcggagctcggttatttagccccttacgtc
ggctggcctcctgggattctaaacccatcagcggccaaaaaagtgataattaatcaaata
gtagctcacgccagggcctacgattcgataaagaaattctcgtctaagcctgtaggagtg
atactaaatataattcctgcttatcctctagatccaaacgattctaagagcgtaagagca
gccgagaattatgatctcttccacaataggctgtttctagaggccgtaaataggggaaac
gttgacttggatatcacaggagaatacaccaaaataccacacataaagagaaacgactgg
atcggaaacaactactatacaagagaggtcgtcaagtacgttgaaccaaaatacgaggaa
ttacccctcatcacattcgtcggtgttgaaggttatggatactctggaaatcccaatagc
ttatccccagataacaatccaacgagtgactttggctgggaggtattcccccagggtctc
tatgactccacgttagaagctgcggagtacaacaaagaggtgttcataacggagaatgga
atagctgactccaaggatatactaagacctaggtacatcattgatcacgtcaatgaagtc
aagaagttgatagaaaatggaataaaagtaggtggatacttccactgggcacttacagat
aattatgagtgggctatgggatttaagattagattcgggttatacgaagtggatttgata
acaaaggagagaatacccaggagaagaagcgttgagatctataaaaaaattgtaatggag
gggatcgaatga

DBGET integrated database retrieval system