KEGG   Pyrococcus horikoshii: PH0501Help
Entry
PH0501            CDS       T00014                                 

Gene name
PH0501
Definition
(GenBank) 483aa long hypothetical beta-mannosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00052  Galactose metabolism
pho00511  Other glycan degradation
pho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PH0501 (PH0501)
  Lipid metabolism
   00600 Sphingolipid metabolism
    PH0501 (PH0501)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PH0501 (PH0501)
Enzymes [BR:pho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PH0501 (PH0501)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: BAA29589
UniProt: O58237
Position
complement(452907..454358)
Genome map
AA seq 483 aa AA seqDB search
MKFYWGVVQSAFQFEMGDPYRRNIDPRSDWWYWVRDPYNIKNDLVSGDLPEEGINNYELY
EIDHRLAKELGLNAYQLTIEWSRIFPCPTFNVEVEFERDGYGLIKKVKIEKEHLEELDKL
ANQKEVRHYLNVLRNLKKLGFTTFVTLNHQTNPIWIHDPIETRGNFQKARARGWVDERTI
IEFAKYAAYVAWKFDNYVDYWSTFDEPMVTAELGYLAPYVGWPPGILNPSAAKKVIINQI
VAHARAYDSIKKFSSKPVGVILNIIPAYPLDPNDSKSVRAAENYDLFHNRLFLEAVNRGN
VDLDITGEYTKIPHIKRNDWIGNNYYTREVVKYVEPKYEELPLITFVGVEGYGYSGNPNS
LSPDNNPTSDFGWEVFPQGLYDSTLEAAEYNKEVFITENGIADSKDILRPRYIIDHVNEV
KKLIENGIKVGGYFHWALTDNYEWAMGFKIRFGLYEVDLITKERIPRRRSVEIYKKIVME
GIE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttactggggcgtcgttcagtctgcatttcaatttgaaatgggggatccctac
aggaggaacatagatcccagaagcgattggtggtattgggtcagagatccatataacata
aagaatgacctcgtcagtggagacctaccagaagagggaataaataactatgaactttat
gaaatagatcataggttagcaaaagagcttggattgaatgcttatcaattaacgatagag
tggagcagaatattcccttgccccaccttcaatgtagaggttgaatttgaaagagacggg
tacgggctcataaaaaaggtgaaaatagaaaaggaacacttagaggagctcgataagctt
gcaaatcaaaaggaagttaggcattacctgaatgttttaaggaatttgaaaaaacttgga
tttacaacattcgtcactttgaaccaccagacaaatcccatatggatccatgaccccata
gaaactagggggaacttccaaaaggctagagcaagaggatgggttgacgaaaggacaatc
atagaattcgcgaagtatgcagcctatgtagcctggaagttcgacaactatgtagattac
tggtcaacatttgatgaaccaatggttacagcggagctcggttatttagccccttacgtc
ggctggcctcctgggattctaaacccatcagcggccaaaaaagtgataattaatcaaata
gtagctcacgccagggcctacgattcgataaagaaattctcgtctaagcctgtaggagtg
atactaaatataattcctgcttatcctctagatccaaacgattctaagagcgtaagagca
gccgagaattatgatctcttccacaataggctgtttctagaggccgtaaataggggaaac
gttgacttggatatcacaggagaatacaccaaaataccacacataaagagaaacgactgg
atcggaaacaactactatacaagagaggtcgtcaagtacgttgaaccaaaatacgaggaa
ttacccctcatcacattcgtcggtgttgaaggttatggatactctggaaatcccaatagc
ttatccccagataacaatccaacgagtgactttggctgggaggtattcccccagggtctc
tatgactccacgttagaagctgcggagtacaacaaagaggtgttcataacggagaatgga
atagctgactccaaggatatactaagacctaggtacatcattgatcacgtcaatgaagtc
aagaagttgatagaaaatggaataaaagtaggtggatacttccactgggcacttacagat
aattatgagtgggctatgggatttaagattagattcgggttatacgaagtggatttgata
acaaaggagagaatacccaggagaagaagcgttgagatctataaaaaaattgtaatggag
gggatcgaatga

DBGET integrated database retrieval system