KEGG   Pyrococcus horikoshii: PH0501Help
Entry
PH0501            CDS       T00014                                 

Definition
beta-mannosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pho  Pyrococcus horikoshii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PH0501
  Lipid metabolism
   00600 Sphingolipid metabolism
    PH0501
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PH0501
Enzymes [BR:pho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PH0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(452907..454358)
Genome map
AA seq 483 aa AA seqDB search
MKFYWGVVQSAFQFEMGDPYRRNIDPRSDWWYWVRDPYNIKNDLVSGDLPEEGINNYELY
EIDHRLAKELGLNAYQLTIEWSRIFPCPTFNVEVEFERDGYGLIKKVKIEKEHLEELDKL
ANQKEVRHYLNVLRNLKKLGFTTFVTLNHQTNPIWIHDPIETRGNFQKARARGWVDERTI
IEFAKYAAYVAWKFDNYVDYWSTFDEPMVTAELGYLAPYVGWPPGILNPSAAKKVIINQI
VAHARAYDSIKKFSSKPVGVILNIIPAYPLDPNDSKSVRAAENYDLFHNRLFLEAVNRGN
VDLDITGEYTKIPHIKRNDWIGNNYYTREVVKYVEPKYEELPLITFVGVEGYGYSGNPNS
LSPDNNPTSDFGWEVFPQGLYDSTLEAAEYNKEVFITENGIADSKDILRPRYIIDHVNEV
KKLIENGIKVGGYFHWALTDNYEWAMGFKIRFGLYEVDLITKERIPRRRSVEIYKKIVME
GIE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttactggggcgtcgttcagtctgcatttcaatttgaaatgggggatccctac
aggaggaacatagatcccagaagcgattggtggtattgggtcagagatccatataacata
aagaatgacctcgtcagtggagacctaccagaagagggaataaataactatgaactttat
gaaatagatcataggttagcaaaagagcttggattgaatgcttatcaattaacgatagag
tggagcagaatattcccttgccccaccttcaatgtagaggttgaatttgaaagagacggg
tacgggctcataaaaaaggtgaaaatagaaaaggaacacttagaggagctcgataagctt
gcaaatcaaaaggaagttaggcattacctgaatgttttaaggaatttgaaaaaacttgga
tttacaacattcgtcactttgaaccaccagacaaatcccatatggatccatgaccccata
gaaactagggggaacttccaaaaggctagagcaagaggatgggttgacgaaaggacaatc
atagaattcgcgaagtatgcagcctatgtagcctggaagttcgacaactatgtagattac
tggtcaacatttgatgaaccaatggttacagcggagctcggttatttagccccttacgtc
ggctggcctcctgggattctaaacccatcagcggccaaaaaagtgataattaatcaaata
gtagctcacgccagggcctacgattcgataaagaaattctcgtctaagcctgtaggagtg
atactaaatataattcctgcttatcctctagatccaaacgattctaagagcgtaagagca
gccgagaattatgatctcttccacaataggctgtttctagaggccgtaaataggggaaac
gttgacttggatatcacaggagaatacaccaaaataccacacataaagagaaacgactgg
atcggaaacaactactatacaagagaggtcgtcaagtacgttgaaccaaaatacgaggaa
ttacccctcatcacattcgtcggtgttgaaggttatggatactctggaaatcccaatagc
ttatccccagataacaatccaacgagtgactttggctgggaggtattcccccagggtctc
tatgactccacgttagaagctgcggagtacaacaaagaggtgttcataacggagaatgga
atagctgactccaaggatatactaagacctaggtacatcattgatcacgtcaatgaagtc
aagaagttgatagaaaatggaataaaagtaggtggatacttccactgggcacttacagat
aattatgagtgggctatgggatttaagattagattcgggttatacgaagtggatttgata
acaaaggagagaatacccaggagaagaagcgttgagatctataaaaaaattgtaatggag
gggatcgaatga

DBGET integrated database retrieval system