KEGG   Pyrococcus horikoshii: PH0682Help
Entry
PH0682            CDS       T00014                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PH0682 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0682 (porD)
   00020 Citrate cycle (TCA cycle)
    PH0682 (porD)
   00620 Pyruvate metabolism
    PH0682 (porD)
   00640 Propanoate metabolism
    PH0682 (porD)
   00650 Butanoate metabolism
    PH0682 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PH0682 (porD)
   00680 Methane metabolism
    PH0682 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PH0682 (porD)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PH0682 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
606773..607099
Genome map
AA seq 108 aa AA seqDB search
MMDMAESPFKADIERAQKELTEKMTPGAIAYIPGSSVINKTGSWRVFKPEFHKDKCVRCF
LCYIYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtgatggatatggccgaaagcccatttaaagccgatattgagagggcgcaaaaagaatta
acggaaaaaatgactcctggagcaatagcctacatcccaggaagtagcgtaattaacaag
acaggctcttggagagtcttcaagccggaattccataaggacaaatgtgtaagatgcttc
ctatgctacatatattgtcctgaaccggcaatatacctagacgaggagggttacccagtc
ttcgactatgattattgtaagggttgtggtatatgtgcaaatgagtgtccaacaaaagca
attgaaatggttagggaagttaagtga

DBGET integrated database retrieval system