KEGG   Pyrococcus horikoshii: PH0682Help
Entry
PH0682            CDS       T00014                                 

Gene name
PH0682
Definition
(GenBank) 108aa long hypothetical ferredoxin oxidoreductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00010  Glycolysis / Gluconeogenesis
pho00020  Citrate cycle (TCA cycle)
pho00620  Pyruvate metabolism
pho00640  Propanoate metabolism
pho00650  Butanoate metabolism
pho00680  Methane metabolism
pho00720  Carbon fixation pathways in prokaryotes
pho01100  Metabolic pathways
pho01120  Microbial metabolism in diverse environments
pho01130  Biosynthesis of antibiotics
pho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0682 (PH0682)
   00020 Citrate cycle (TCA cycle)
    PH0682 (PH0682)
   00620 Pyruvate metabolism
    PH0682 (PH0682)
   00640 Propanoate metabolism
    PH0682 (PH0682)
   00650 Butanoate metabolism
    PH0682 (PH0682)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PH0682 (PH0682)
   00680 Methane metabolism
    PH0682 (PH0682)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PH0682 (PH0682)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PH0682 (PH0682)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_16 Fer4_9 Fer4_10 Fer4_4 Fer4_17 Fer4_22 Fer4_8 Fer4_15 RPAP1_N
Motif
Other DBs
NCBI-ProteinID: BAA29773
UniProt: O58415
Position
606773..607099
Genome map
AA seq 108 aa AA seqDB search
MMDMAESPFKADIERAQKELTEKMTPGAIAYIPGSSVINKTGSWRVFKPEFHKDKCVRCF
LCYIYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtgatggatatggccgaaagcccatttaaagccgatattgagagggcgcaaaaagaatta
acggaaaaaatgactcctggagcaatagcctacatcccaggaagtagcgtaattaacaag
acaggctcttggagagtcttcaagccggaattccataaggacaaatgtgtaagatgcttc
ctatgctacatatattgtcctgaaccggcaatatacctagacgaggagggttacccagtc
ttcgactatgattattgtaagggttgtggtatatgtgcaaatgagtgtccaacaaaagca
attgaaatggttagggaagttaagtga

DBGET integrated database retrieval system