KEGG   Pyrococcus horikoshii: PH0682Help
Entry
PH0682            CDS       T00014                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pho01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pho00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pho00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pho00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pho00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pho00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:pho00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
606773..607099
Genome map
AA seq 108 aa AA seqDB search
MMDMAESPFKADIERAQKELTEKMTPGAIAYIPGSSVINKTGSWRVFKPEFHKDKCVRCF
LCYIYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVREVK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtgatggatatggccgaaagcccatttaaagccgatattgagagggcgcaaaaagaatta
acggaaaaaatgactcctggagcaatagcctacatcccaggaagtagcgtaattaacaag
acaggctcttggagagtcttcaagccggaattccataaggacaaatgtgtaagatgcttc
ctatgctacatatattgtcctgaaccggcaatatacctagacgaggagggttacccagtc
ttcgactatgattattgtaagggttgtggtatatgtgcaaatgagtgtccaacaaaagca
attgaaatggttagggaagttaagtga

DBGET integrated database retrieval system