KEGG   Pyrococcus horikoshii: PH0684Help
Entry
PH0684            CDS       T00014                                 

Gene name
porA
Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PH0684 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0684 (porA)
   00020 Citrate cycle (TCA cycle)
    PH0684 (porA)
   00620 Pyruvate metabolism
    PH0684 (porA)
   00640 Propanoate metabolism
    PH0684 (porA)
   00650 Butanoate metabolism
    PH0684 (porA)
  Energy metabolism
   00680 Methane metabolism
    PH0684 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PH0684 (porA)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PH0684 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
607106..608302
Genome map
AA seq 398 aa AA seqDB search
MFFMPIRTVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVE
SEHSAISAVVGASAAGVRTFTATASQGLALMHEVLFIAAGMRLPIVMAIGNRSLSAPINI
WNDWQDSISQRDTGWIQFYAENNQEALDLILLAYKVAEDERVLLPAMVGFDAFILTHTVE
PVEIPDQEVVDEFLGEYEPKHAYLDPKRPITQGTLAFPAHYMEAKYLVWDAMEKARKVID
EAFAEFEKRFGRKYQKIEEYKTDDAEIIFVTMGSLAGTLKDWVDKKREEGYKVGAAKMTV
YRPFPVEEIRALAKKAKVLGFIEKDISIGLYGAVFIDASAALVNESERPLMLDFIAGLGG
RDVTFGQLDDALRIAEEALEKGEVEKPIHWIGLRKELL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgttttttatgccaattagaactgttatgaaggctaacgaggccgccgcatgggcggct
aagcttgcaaagcctaaggtaatagctgcattcccaattacaccatcaactctagttccc
gaaaagattagtgaattcgtcgcaaatggagaactcgatgctgaattcataaaggttgaa
agtgaacactcagcaatctccgcagtggtgggggctagtgcggctggagttagaaccttc
acggctacagcttctcaaggtttagcccttatgcatgaagtcctattcatagcggctgga
atgaggttacctatcgtaatggcaattggtaacagatcgttaagtgctccaattaacatt
tggaacgactggcaggactcaataagtcagagagataccggttggatccaattctatgct
gagaacaaccaagaggccttagacttaatcctcctagcctataaggttgccgaggatgaa
agagttctccttccagcaatggtaggctttgatgcattcatcctaacgcacaccgtcgag
ccggttgagattccagatcaggaagtcgtagatgaattcctgggagaatatgagcccaag
catgcataccttgatccaaagaggcccataacccagggtacactagccttcccggcccac
tatatggaggccaaatacctagtctgggatgctatggagaaggctaggaaggtaatagat
gaggcctttgcagagttcgagaagaggttcggaaggaagtaccagaagatagaggaatac
aaaactgatgatgccgagataattttcgtcacaatgggttcactagccggaacccttaaa
gactgggtagataagaagagggaagagggatacaaggttggagcagctaaaatgacagtt
tacaggcccttcccagttgaggaaataagggccctcgctaagaaggcgaaggttcttgga
ttcatagagaaggatataagcataggtctctacggtgcagtcttcatagatgcctccgcg
gctttagtaaatgaaagcgagaggccactaatgctggacttcatagctggccttggtgga
agggatgtcaccttcggccagttagacgatgcactaaggattgcagaagaggcccttgag
aagggtgaagttgagaagccaattcactggatcggattgaggaaggaattattgtga

DBGET integrated database retrieval system