KEGG   Pyrococcus horikoshii: PH0685Help
Entry
PH0685            CDS       T00014                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PH0685
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0685
   00020 Citrate cycle (TCA cycle)
    PH0685
   00620 Pyruvate metabolism
    PH0685
   00640 Propanoate metabolism
    PH0685
   00650 Butanoate metabolism
    PH0685
  Energy metabolism
   00680 Methane metabolism
    PH0685
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PH0685
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PH0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608304..609308
Genome map
AA seq 334 aa AA seqDB search
MINMAVRKPPITTREYWAPGHAACAGCGCAIALKLATKAFSEAMEEKYGDPNAFAIAQAT
GCMEVVSAVFPYTAWKVPWIHVAFENAAAAASGVEAAWKKLGIKGKILAIGGDGGTADIG
LQALSGMLERGHNVVYLMYDNEAYMNTGIQRSSSTPYGAWTTTSPPGKYSIGEDRPKKWV
ALIAAAHQIPYAATASIGNPFDLVKKVKKAAKVDGPAFIQVHCTCPTGWRTPLEKGVEIA
RLAIETGMWPLFEIENGDIWNIKIQPPGGGAKVYKEGGRVVRIEFKKPIEEYLKYQGRFK
HLFKRPEAIEELRNQIKAMWKVLGVEAILPRPEE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatatggccgttagaaagcctcccattactactcgtgaatattgggctcctggt
catgctgcatgtgctggttgtggatgtgctatagccctaaagttggcaaccaaagcattc
agcgaagctatggaagagaagtatggtgatccaaatgcattcgcaatcgctcaagccact
ggttgtatggaagtcgtctcagctgtattcccatacaccgcttggaaagttccatggatt
catgttgcatttgaaaatgccgctgcagcagcttctggagttgaagctgcatggaaaaag
cttggtataaagggtaagatactagccataggtggagacggaggtaccgcagatatagga
ttgcaggcactttccggaatgcttgagagaggccacaacgtcgtttacctcatgtacgat
aatgaggcttacatgaatactggaattcagaggtcttcatcaacaccctacggagcatgg
acaacgacttcacccccaggaaagtattccattggtgaggatagaccaaagaagtgggtt
gcgttaatagctgcggcccaccagataccttatgctgcaactgctagcattggtaatcca
ttcgatctagtgaagaaagttaaaaaagctgctaaggttgacggtccagcctttatacaa
gttcactgtacctgtccaacaggatggagaaccccacttgagaagggagttgagatagct
aggttagctattgaaaccggaatgtggccactctttgagattgaaaacggagatatatgg
aacataaagatacagcccccaggaggaggggccaaggtttacaaggaaggaggaagggtt
gtaaggatagagttcaagaaacccatagaggagtacctcaagtaccagggaagattcaag
cacctcttcaagagaccggaagcaattgaagaactcaggaatcaaataaaggccatgtgg
aaagtccttggagttgaggccattctcccaaggcctgaggagtga

DBGET integrated database retrieval system