KEGG   Pyrococcus horikoshii: PH0743Help
Entry
PH0743            CDS       T00014                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PH0743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0743
  Lipid metabolism
   00071 Fatty acid degradation
    PH0743
  Amino acid metabolism
   00350 Tyrosine metabolism
    PH0743
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PH0743
   00626 Naphthalene degradation
    PH0743
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PH0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656991..658118
Genome map
AA seq 375 aa AA seqDB search
MTFFLKTTILMGRGSLENIKKLVSEGERVLVFSSKSMDRLGFLKEVIDYLDEAGATYESI
TGLPSEPSIENVEELLPKVKDFSPETFIALGGGSVIDISKALKVFYDAPELDFDSVAIFS
RFKKAQPLPKLKTKLIAVPSTSGAGSEVSAATVIKKGDIKYTIVSPELCPNYAILDPRLP
ENMPREVARNSGLDVLVHAIEAYVSKASTPFSDAMAVKAARTILEKLEDSVNGDPTAREE
VHYAATMAGIAFLNGRLGLVHAMSHKAAWIGPHGLINAILLPYVMEFNMEKAREKYDAMA
KELGLSNAEELLQKVKELNERLNVPKLSEIVSEEDFTSRLDEMSRKAYEDPLVNFNPVEP
SVDDIKNIYLRAFHD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacattcttcctaaagactaccatattaatgggtaggggatcccttgaaaatataaaa
aagcttgtatctgaaggtgagagggtactcgtcttttcttcaaagtctatggataggctt
ggctttttaaaagaggtaattgactatttagacgaagcaggtgcaacctatgaaagtatt
acgggattaccttccgagccaagcattgaaaacgttgaggaattgctcccaaaggtcaag
gatttctctccggaaaccttcatagcactcggtggagggagcgtgatagatatctcaaaa
gccctgaaagttttctatgatgctcctgaacttgattttgacagtgttgcaatatttagc
agatttaaaaaagctcaacctcttccaaagcttaaaacaaagcttatagccgttccttct
acgagtggtgcagggagtgaagtatccgctgcgaccgtgataaagaagggggatatcaag
tacacgatagtgagtccagagctttgtccaaattatgcaatcttggatccgagactcccc
gagaacatgcccagggaagtagctaggaactctggattagatgtattagttcatgccata
gaagcttacgtttcaaaggcatcaacaccttttagtgatgctatggccgtaaaagcagca
aggacaattcttgaaaagcttgaagatagcgttaatggcgatcctaccgctagagaagaa
gttcattatgccgccactatggccggaatagccttcctaaatggtagacttggactcgtc
catgcaatgagtcataaagcagcgtggattggccctcatggattgattaatgcgatacta
ctcccatatgtaatggagttcaatatggaaaaagctagagaaaagtacgatgcaatggcc
aaggaacttgggctttccaatgctgaagaacttcttcagaaggttaaagagctcaatgaa
agattaaacgttccaaagttatcggaaatagttagcgaggaagatttcacttcaaggctt
gatgagatgagcagaaaggcttacgaagatcccctggttaacttcaatccagtggaacca
agcgttgatgatataaagaacatctatctgagggccttccatgattga

DBGET integrated database retrieval system