KEGG   Pyrococcus horikoshii: PH0759Help
Entry
PH0759            CDS       T00014                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PH0759
   01230 Biosynthesis of amino acids
    PH0759
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0759
   00030 Pentose phosphate pathway
    PH0759
   00051 Fructose and mannose metabolism
    PH0759
  Energy metabolism
   00680 Methane metabolism
    PH0759
Enzymes [BR:pho01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PH0759
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PH0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669143..670315
Genome map
AA seq 390 aa AA seqDB search
MVINSINWLFSEVVAMAVGEKITISVIKADVGGWPGHSRVHPALIEKAREVLSEAQKNGT
IIDFYVTYAGDDLQLIMTHKKGVDSPEVHGLAWEAFKKATEVAKELGLYGAGQDLLKDAF
SGNVRGLGPSVAEMEITLRKSEPIVTFHLDKTEPGAFNLPIFRMFADPFNTAGLVIDPKM
HMGFRFEIWDILEHKKVIMSSPEEMYDILALIGAKSRYVIKRVYPKEGHPVPKDEPVAVV
STEKLYEVAGEYVGKDDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVP
LKYATPTRFDGPPRAVALGWQISPEGKLIGPVDLFDDPAFDWARQKALEITDYIRRHGPF
EPHRLPSEEMEYTTLPGVLEKLKDRFEPIE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggttataaatagtataaattggcttttttcagaggtggttgcgatggccgttggtgag
aagataactataagcgttataaaggctgatgttggtggatggccgggacactccagagtt
catccagccctaattgaaaaggccagggaggttctttctgaagcccagaagaacgggacg
ataatagacttctacgtaacttacgctggagatgaccttcagctgatcatgacccataag
aagggtgtagacagccccgaggttcacgggttagcttgggaggcatttaagaaggctact
gaggttgctaaggagcttggtctttacggagctggtcaggacttgcttaaagatgccttt
agtggtaacgttagaggactgggaccaagcgttgctgagatggaaataaccttaagaaag
agcgagccaatagttaccttccacttagataagaccgagccgggagctttcaacctaccg
atctttaggatgtttgcagatccctttaatactgcagggttagtcatagatccaaagatg
cacatgggattcaggtttgagatctgggatattttagagcacaagaaggttataatgagc
tctccagaggaaatgtacgacatcttagccttaataggagccaagagcaggtacgttatc
aagagggtctatccaaaggagggccacccagtaccaaaggatgaaccagttgctgtagtc
tcaactgagaagctttatgaagttgcaggagagtacgtaggaaaagatgatcctgtagca
atagtaagagcccaaagtggccttccagccctgggagaagttctagaaccatttgcattc
ccacacttggttagtggatggatgagaggtagccacaacggcccactaatgccagttcct
ctaaagtatgcaacgccaacgagattcgatggaccacctagggccgtagctctaggatgg
cagataagcccggaaggaaagcttatcggacccgttgacctcttcgatgatcctgcattt
gattgggcgagacagaaggccctagagataactgattacataagaaggcatgggcctttc
gaaccacacaggctaccatctgaggaaatggagtacacaacccttccaggagttctagaa
aagttaaaggatagatttgagccgatagagtag

DBGET integrated database retrieval system