KEGG   Pyrococcus horikoshii: PH0999Help
Entry
PH0999            CDS       T00014                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pho  Pyrococcus horikoshii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:pho00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
907656..908198
Genome map
AA seq 180 aa AA seqDB search
MPEEALIVVDMQRDFMPGGALPVPEGDKIIPKVNEYIRKFKEKGALIVATRDWHPENHIS
FRERGGPWPRHCVQNTPGAEFVVDLPEDAVIISKATEPDKEAYSGFEGTDLAKILRGNGV
KRVYICGVATEYCVRATALDALKHGFEVYLLRDAVKGIKPEDEERALEEMKSRGIKIVQF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagaagccttaatagttgttgatatgcagagagatttcatgcctggaggagct
cttccggttcctgagggagataagataattccaaaggttaacgagtacataaggaagttt
aaggaaaagggagctttaatagtggccacaagggattggcatcctgaaaatcacataagc
tttagggagaggggaggcccctggcccaggcattgcgttcaaaacactcctggtgcagag
ttcgtggtagatttaccggaagatgccgtgatcatttcgaaagctacagagccagataaa
gaagcatattctggctttgaaggtacagatcttgcgaaaattctaagagggaatggagtt
aagagagtttatatctgtggtgttgctacggagtactgcgtcagggcaacggccttagac
gctcttaagcatgggtttgaagtctacctcttaagggatgcagtaaagggaatcaaacct
gaagacgaggagagagcccttgaggagatgaaatctagagggattaagatcgttcagttt
tag

DBGET integrated database retrieval system