KEGG   Pyrococcus horikoshii: PH1274Help
Entry
PH1274            CDS       T00014                                 

Definition
formaldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pho  Pyrococcus horikoshii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PH1274
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PH1274
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PH1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144459..1146336
Genome map
AA seq 625 aa AA seqDB search
MVNFMKGWWGRILRVNLTTGEVKVQEYPEEIAKKFIGGRGLAAWILWNEVKGVDPLSPEN
KLVIAAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVIEGKAK
KPVYLYIEDDNVSILSAEGLWGKGTFETEKELKKIHGKNVGVLSIGPAGENLVKFAVVIS
QEGRAAGRPGMGAVMGSKKLKAIVVRGTKDIPVADKDELKKLSQEAYTDILNAPGYPFWK
RQGTMATIEWANENSALPTRNFSDGIFELARPIDGYTMEGMKINQRGCPYCNMPCGNVVL
DAEGQESELDYENVALLGSNLGIGKLNEVAVLNRIADDMGMDTISLGGVLGFVMEAKERG
LIKDDEAPEFGDFKKAKELALNIAYRRTELGNFAAEGVKRMAEKLGDDSFAMHVKGLEVS
GYNCYIYPGMALAYGTSSIGAHHKEAWVIAWEIGTAPIEGEQAEKVEYKISYDPIKAQKV
VELQRLRGGLFEMLTACRLPWVEIGLSLEYYPKLLKAITGVTYTWDDLYKAADRVYALIR
AYWVREFNGNWSREMDYPPKRWFNEGLKSGPYKGQHLDRDKYDALLSEYYRIRGWDERGI
PKKETLKQLELDFVIPELEKVTKLE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacttcatgaaaggatggtggggcaggattctgagggttaacttaactacaggg
gaagttaaagtccaagaatatcccgaagagatcgcgaagaagtttattggtggaagaggc
ctagctgcatggattctttggaacgaagttaagggcgttgaccctctaagcccagagaac
aagctcgttattgctgcgggacccttcaacggccttccaacaccaagtggtggtaagctc
gtagtggccgctaagagtccgctaactggaggttatggcgacggtaacttaggaaccatg
gcctcagtccacctaagaagggccgggtacgatgctttagtcatcgagggaaaagctaag
aagccagtctatctctacattgaggatgataacgtgagcattctaagtgctgaggggctt
tgggggaaaggaaccttcgaaacagagaaggagctaaagaagatccacggtaagaacgtt
ggagttctaagcataggacctgctggagagaacttagttaagttcgcagttgttatatcc
caagaagggagagcagcgggaagacctggaatgggtgcggtaatgggaagcaagaagctc
aaggctatcgttgtaaggggaactaaagatattcccgttgcggataaagatgagctgaag
aagcttagtcaagaggcctataccgatatactaaacgctccaggatatccattctggaag
aggcaaggtactatggcaactattgagtgggcgaatgaaaactccgcactaccaaccagg
aacttcagcgatggaatcttcgagcttgcaaggcctatcgatggatacaccatggaaggt
atgaagatcaatcagaggggatgtccatactgtaatatgccctgtgggaacgtagtcctt
gatgccgaggggcaggaaagtgaattggactatgagaacgtcgcattgttaggatctaac
ctcggaatcgggaagcttaacgaagttgccgttctcaacaggatagctgacgatatgggt
atggataccataagccttggaggagttctgggcttcgttatggaagctaaagagagggga
ttaataaaggatgatgaagccccagagtttggagacttcaagaaggccaaagaactagcc
ttgaacatagcttatagaagaacagaacttggaaactttgctgcggaaggagttaagagg
atggccgaaaagcttggagatgacagctttgcaatgcacgtgaaagggctagaggtcagc
ggttacaattgttacatctacccaggaatggccttagcctatggaacgagctcaatagga
gctcaccataaggaagcttgggttatagcttgggagattggaactgcaccgatagaagga
gagcaggccgagaaggttgaatacaagataagctacgatccaataaaggcccagaaggtg
gttgaactccagaggctcaggggaggactcttcgagatgctcaccgcatgtagattacca
tgggttgaaattggattaagcctggagtactatccgaagttgcttaaggctataactgga
gttacctatacatgggatgacctatacaaagcagctgacagggtttacgcattaataagg
gcttactgggttagagaattcaacggtaactggagcagagaaatggattatccaccaaag
aggtggttcaacgagggattgaagagtggcccatacaagggacagcacttggatagggat
aagtatgatgcattactttcggagtactatagaattaggggatgggatgaaagaggaatt
ccaaagaaggagacacttaagcaactcgagctagacttcgtgattccagagcttgaaaag
gtaactaagctcgagtga

DBGET integrated database retrieval system