KEGG   Pyrococcus horikoshii: PH1288Help
Entry
PH1288            CDS       T00014                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pho  Pyrococcus horikoshii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pho01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pho00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157631..1158998)
Genome map
AA seq 455 aa AA seqDB search
MINIFKPRTLTFYLVKSMDVLELLSELVSFNTVNDPNKGIKPSKECPRFIKDQLDSWDIE
SEIIERSGYYAVYGEIGDGTPRLLFMAHFDVVPVNLEEWETDPFELTIKENKAYGRGSAD
DKGNVAAVMLALKELSKEEKLNGRVIFAFTGDEEIGGAMAMHIAEKLSKEGKVPKYMINA
DGIGMKPIIRRRKGFGVEIKVYPRKVKVKGRVREIEFEPKTPVVETRHAAYFLPGVDTHP
MVALSHFLRNSNAVAISLDGAFIKGNVIPGKVKLKYVEPGEGEEVEGDLSLTALLKAIVP
IVRAPIKAEKYSDYGVSITPNVYSFDGSHVLKVDVRAMSYSKDDIEKTLREVLNFNLPEA
ELIIKENEKAGYLFTSPDDELVRVTLRILKELGEDVEPIEGPGASDSRYFTPLGVKAIDI
GPRGGNIHGPNEYVEVDSLRKMPEIYRRIALSLLL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgataaatatatttaagccccgcaccttgaccttttatttggtgaaaagtatggatgta
ctggagctcctttccgaattggtctcctttaacaccgtcaatgaccctaataaagggatt
aagccttctaaagagtgcccaaggtttattaaagaccagctggactcctgggatatagag
tctgagatcatagagagaagcggctactatgcagtttatggggaaataggagatggtact
cctaggcttctctttatggcccacttcgatgttgttccagtgaatcttgaggaatgggaa
accgatcctttcgagctaacgattaaggaaaacaaagcgtacggaaggggtagtgctgac
gacaagggtaacgtggctgcggtcatgcttgcgttaaaggagctttccaaagaagaaaag
ctaaatggtagggtaatttttgcatttactggagatgaggaaataggaggagcaatggca
atgcacatagctgaaaagctttcaaaggagggtaaagtacccaagtacatgattaatgct
gatggaataggaatgaaacccattatacgcagaagaaagggattcggggtggagattaaa
gtttatccaagaaaagtgaaggtaaaggggagggtaagggaaatagagttcgaacctaaa
actccagttgtcgagacaagacatgcagcttacttcctcccgggagttgatactcatccg
atggtagcactttctcacttcctgaggaattcaaatgcagtagcaatatccctggatggg
gctttcattaagggtaacgttattccaggaaaagttaagctgaaatacgtcgaacctggg
gaaggagaggaagttgaaggagatctaagtttgactgctttgttaaaagccatcgttcca
attgttagggccccgattaaagcagagaagtatagtgactacggagtttcgataactcca
aatgtttactcctttgatggaagtcacgtgctaaaggttgacgttagggctatgagttac
tcaaaggatgatattgaaaaaacgctgagggaagttcttaactttaatctccctgaagca
gagttaatcatcaaggagaacgagaaggctggttatctatttacgagccccgatgacgag
cttgttagagttactcttaggatcttaaaagagctaggggaagacgttgaacctatagaa
ggtccgggagcctcggattcaagatactttactccccttggagtcaaagctatagacata
ggacccaggggagggaacattcatgggcctaatgagtacgttgaagtagattctctcagg
aagatgcccgaaatttataggagaatcgcgctatctctattgttgtga

DBGET integrated database retrieval system