KEGG   Pyrococcus horikoshii: PH1406Help
Entry
PH1406            CDS       T00014                                 

Gene name
PH1406
Definition
(GenBank) 440aa long hypothetical threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PH1406 (PH1406)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PH1406 (PH1406)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PH1406 (PH1406)
Enzymes [BR:pho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PH1406 (PH1406)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1265487..1266809
Genome map
AA seq 440 aa AA seqDB search
MKCPRCGREYISSIPPFCICGEELEITYDYSSVDVRKWKRRNPGVWRYKELLPEVKKIIT
LQEGGTPLIKARISEKINVDVYIKDETRNPTGSFRDRLATVAISYGLPYASNGFIVASDG
NAAASVAAYSARAEKECFVVVPRKVDKGKLIQMIAFGARIIRYGDSVDEAIEYARELSKL
NGLYNVTPEDNIIGLEGQKTIAFELWEEINPTHVIVPTGSGSYIYSIYKGFKELIKIGVL
EKMPRLIAVQTERCNPIAAEILGLKKECKETKALGLYVKNPVMKSRVIRAIKESGGTAVV
VNENDIITGEKLLANEGIFAELSSAVVMPALLSLVEKGIIEKGDKVVLVVTGSGLKIGEG
GREKFSIGGTKLEILKILEEREMYAYEIWQALGKPLKYQAVHQHIKELQELGLIKEAYRK
GKRIYYKLTERGRRLIENLE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcccaagatgtggtagggaatacatatcttcaatcccacctttttgtatctgt
ggggaagagctcgagataacttatgattattcctctgtagacgtgagaaaatggaaaaga
agaaatcctggggtatggagatataaagagcttctgccagaagttaagaagatcataacc
ctacaagagggaggaacaccactaataaaggctaggataagcgagaaaatcaacgttgat
gtttatataaaagatgaaaccagaaatccaaccggctcctttagggataggttagccaca
gttgcaatctcctatggtttaccttacgcatcaaatggatttatagttgcgagtgatgga
aatgcagctgcttcagtcgctgcttactcggcaagagctgaaaaggagtgcttcgtagtt
gttcccaggaaagttgataaaggaaagctaattcaaatgatagcctttggagcgaggata
atacgctatggtgacagcgttgatgaagcaatagaatatgcaagagagctttcaaaactt
aacggcttatacaatgtcacacccgaggataatataatcggacttgagggtcagaagacg
atagcattcgaactttgggaggaaattaatccaacgcatgtaatagtcccgacgggaagc
gggagttacatatactcgatatacaaggggttcaaggaactcatcaaaattggagtgcta
gagaagatgccaagattaattgccgttcaaacggagagatgcaatcctatagccgctgaa
attttgggattaaaaaaagaatgtaaagaaactaaagctctcggattatatgtgaagaac
ccggtaatgaagtctagagttataagggctataaaggaaagtggaggaacagcagttgtt
gtaaatgaaaacgacataattaccggggaaaagttgctagccaatgaagggatatttgcg
gagctttcctcggccgttgtaatgcccgccctattaagcctagttgaaaagggaataatt
gaaaaaggagataaagtagttttggttgttaccggttcaggactcaaaattggtgaaggg
ggaagagagaaattctccattggtggaactaagcttgagattcttaaaatcctcgaggaa
agagagatgtacgcctatgaaatttggcaagcactaggaaaacccctaaagtatcaagcc
gttcatcagcatataaaggaattacaagagttaggcctcataaaggaggcatatagaaag
gggaagaggatatattacaagctgactgagagaggtagaaggcttattgaaaatcttgag
tag

DBGET integrated database retrieval system