KEGG   Pyrococcus horikoshii: PH1406Help
Entry
PH1406            CDS       T00014                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PH1406
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PH1406
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PH1406
Enzymes [BR:pho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PH1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1265487..1266809
Genome map
AA seq 440 aa AA seqDB search
MKCPRCGREYISSIPPFCICGEELEITYDYSSVDVRKWKRRNPGVWRYKELLPEVKKIIT
LQEGGTPLIKARISEKINVDVYIKDETRNPTGSFRDRLATVAISYGLPYASNGFIVASDG
NAAASVAAYSARAEKECFVVVPRKVDKGKLIQMIAFGARIIRYGDSVDEAIEYARELSKL
NGLYNVTPEDNIIGLEGQKTIAFELWEEINPTHVIVPTGSGSYIYSIYKGFKELIKIGVL
EKMPRLIAVQTERCNPIAAEILGLKKECKETKALGLYVKNPVMKSRVIRAIKESGGTAVV
VNENDIITGEKLLANEGIFAELSSAVVMPALLSLVEKGIIEKGDKVVLVVTGSGLKIGEG
GREKFSIGGTKLEILKILEEREMYAYEIWQALGKPLKYQAVHQHIKELQELGLIKEAYRK
GKRIYYKLTERGRRLIENLE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcccaagatgtggtagggaatacatatcttcaatcccacctttttgtatctgt
ggggaagagctcgagataacttatgattattcctctgtagacgtgagaaaatggaaaaga
agaaatcctggggtatggagatataaagagcttctgccagaagttaagaagatcataacc
ctacaagagggaggaacaccactaataaaggctaggataagcgagaaaatcaacgttgat
gtttatataaaagatgaaaccagaaatccaaccggctcctttagggataggttagccaca
gttgcaatctcctatggtttaccttacgcatcaaatggatttatagttgcgagtgatgga
aatgcagctgcttcagtcgctgcttactcggcaagagctgaaaaggagtgcttcgtagtt
gttcccaggaaagttgataaaggaaagctaattcaaatgatagcctttggagcgaggata
atacgctatggtgacagcgttgatgaagcaatagaatatgcaagagagctttcaaaactt
aacggcttatacaatgtcacacccgaggataatataatcggacttgagggtcagaagacg
atagcattcgaactttgggaggaaattaatccaacgcatgtaatagtcccgacgggaagc
gggagttacatatactcgatatacaaggggttcaaggaactcatcaaaattggagtgcta
gagaagatgccaagattaattgccgttcaaacggagagatgcaatcctatagccgctgaa
attttgggattaaaaaaagaatgtaaagaaactaaagctctcggattatatgtgaagaac
ccggtaatgaagtctagagttataagggctataaaggaaagtggaggaacagcagttgtt
gtaaatgaaaacgacataattaccggggaaaagttgctagccaatgaagggatatttgcg
gagctttcctcggccgttgtaatgcccgccctattaagcctagttgaaaagggaataatt
gaaaaaggagataaagtagttttggttgttaccggttcaggactcaaaattggtgaaggg
ggaagagagaaattctccattggtggaactaagcttgagattcttaaaatcctcgaggaa
agagagatgtacgcctatgaaatttggcaagcactaggaaaacccctaaagtatcaagcc
gttcatcagcatataaaggaattacaagagttaggcctcataaaggaggcatatagaaag
gggaagaggatatattacaagctgactgagagaggtagaaggcttattgaaaatcttgag
tag

DBGET integrated database retrieval system