KEGG   Pyrococcus horikoshii: PH1527Help
Entry
PH1527            CDS       T00014                                 

Gene name
PH1527
Definition
(GenBank) 353aa long hypothetical Frv operon protein FrvX
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
pho  Pyrococcus horikoshii
Brite
Enzymes [BR:pho01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     PH1527 (PH1527)
Peptidases [BR:pho01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   PH1527 (PH1527)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1358462..1359523)
Genome map
AA seq 353 aa AA seqDB search
MEVRNMVDYELLKKVVEAPGVSGYEFLGIRDVVIEEIKDYVDEVKVDKLGNVIAHKKGEG
PKVMIAAHMDQIGLMVTHIEKNGFLRVAPIGGVDPKTLIAQRFKVWIDKGKFIYGVGASV
PPHIQKPEDRKKAPDWDQIFIDIGAESKEEAEDMGVKIGTVITWDGRLERLGKHRFVSIA
FDDRIAVYTILEVAKQLKDAKADVYFVATVQEEVGLRGARTSAFGIEPDYGFAIDVTIAA
DIPGTPEHKQVTHLGKGTAIKIMDRSVICHPTIVRWLEELAKKHEIPYQLEILLGGGTDA
GAIHLTKAGVPTGALSVPARYIHSNTEVVDERDVDATVELMTKALENIHELKI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaggaatatggtggactacgagcttttaaaaaaggtagttgaagcccctgga
gtttctgggtatgaattcttggggattagggatgttgttatagaggagatcaaggactat
gtagatgaagttaaggttgacaagctgggaaacgttatagctcacaagaagggagaaggg
ccaaaagttatgatagcggcccacatggatcagatagggttgatggttactcacatagag
aagaacggattcttaagagttgctccgattggaggagtcgatccaaaaactctgatagct
caaaggtttaaggtctggattgataaaggtaagttcatttatggagttggcgcatcggta
ccgcctcacattcagaagccagaggacaggaagaaggcccctgattgggatcagatattt
atagacataggtgctgaaagcaaggaagaagctgaggatatgggagttaagatcgggacg
gtaattacgtgggatggaagattggaaaggttaggtaagcataggttcgtaagtatagct
tttgatgatagaattgcagtatatacgatactggaagttgccaagcagcttaaggatgct
aaggctgatgtatacttcgttgccactgttcaggaggaggtaggacttagaggtgctaga
acgtcagcatttggaatcgaacccgattatggctttgcgattgatgttactatagcagca
gacattccaggaacgccagagcacaagcaagtaacccacttgggaaagggaactgcgata
aagataatggatcgctcggttatatgccatccaacgatagtaagatggttggaggaattg
gcgaagaagcatgagataccataccagcttgagatcctcttaggtggaggaacggatgcc
ggagcgatccacttaacaaaagcaggtgttccaactggagcattaagcgttccagctagg
tatattcactctaacactgaagtcgttgatgaaagagacgttgacgcaacggttgagcta
atgactaaagcccttgaaaacatccatgagcttaagatctaa

DBGET integrated database retrieval system