KEGG   Pyrococcus horikoshii: PH1583Help
Entry
PH1583            CDS       T00014                                 

Gene name
PH1583
Definition
(GenBank) 459aa long hypothetical tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PH1583 (PH1583)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PH1583 (PH1583)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PH1583 (PH1583)
Enzymes [BR:pho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PH1583 (PH1583)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1404608..1405987
Genome map
AA seq 459 aa AA seqDB search
MIVFGSKAEIHAKSILKDGEIPKRWYNILPDLPEPLSPPLDPETNETINPEKLTRIFAKE
LIKQEFSEKRYIKIPKEVRELYAKIGRPTPLFRATNLEKILKTPARIYFKYEGATVTGSH
KINTALAQAYYAKKEGIKRLVTETGAGQWGTALSLAGALIGLKVRVYMTRASYYQKPYRK
ILMEIYGAEVFPSPSENTEVGKRFLREDPNHPGSLGIAISEAIEDVLSDEKARYSLGSVL
NHVLMHQTVIGLEAKKQVKEFEEPDVIIGCVGGGSNFAGLSYPFIKDVLDGKAEYEFIAV
EPRAVPTMTKGVYTYDYGDSAGLTPKIKMYTLGHTYYVPPIHAGGLRYHGLAPTLSVLMN
HGIVKPMAYHQTEVFEAAVLFAKAEGIVPAPESAHAVRAVIDKALEAKRKGEETVILFNL
SGHGLLDLKGYEDYLEGKLEDYEPQILNLSMAPRPPNAL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtttttggatccaaagcagaaatccacgctaagtcaatactgaaggatggagaa
attccaaagagatggtataatatcctaccggatcttccagaacctctaagcccccctctc
gatccagagacgaatgaaacaattaacccagaaaaactaactaggatatttgcaaaagag
ctaataaagcaagaatttagtgagaagaggtacatcaagatacccaaagaggtaagagaa
ctgtatgcaaaaataggaaggcctacaccgctttttagagctacaaatctggagaaaatc
ttgaaaactcctgcaaggatttactttaaatatgaaggagctacagtaactgggagtcac
aagataaataccgcactagcccaagcttattatgccaagaaggaagggatcaaaagactc
gtcactgaaacgggagcaggacagtgggggactgctctaagtttagccggggcattaatt
ggtcttaaagttagagtttacatgaccagggctagttactaccagaaaccgtacagaaag
attctaatggaaatctacggagctgaagtcttcccaagtccgagcgagaacaccgaggta
gggaaaaggttcctcagggaagatccaaatcatccaggaagcttgggaatagccattagc
gaagctatagaagatgttctaagtgatgagaaggccagatattccctggggagcgtttta
aatcatgtcctgatgcatcaaaccgtgattggactagaggccaaaaagcaggttaaagag
ttcgaagagccggatgtaataattggatgcgtaggtgggggaagcaacttcgctggatta
agctacccatttataaaggatgtcctagatggaaaagcggagtacgaatttatagccgtg
gagcccagggccgttccaactatgaccaaaggagtttacacttacgattatggcgattct
gctggcttaacaccaaagataaagatgtataccctagggcacacctactatgttccaccc
atacatgcaggtggattaagataccatggactagcaccaacccttagcgtactcatgaat
cacggaatagtaaagccaatggcatatcatcagacggaggtatttgaagcggccgttctc
tttgcaaaagcggaagggatagttccagcaccggaaagtgcacatgcagttagggcagta
attgataaggcgttagaggccaaaagaaagggagaagaaactgtgatactcttcaatcta
agcggacatggacttttagatttaaaggggtatgaagactatctagaggggaagctcgag
gattacgaacctcaaatcttaaacctaagtatggccccgaggccaccaaatgccctatag

DBGET integrated database retrieval system