KEGG   Pyrococcus horikoshii: PH1583Help
Entry
PH1583            CDS       T00014                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PH1583
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PH1583
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PH1583
Enzymes [BR:pho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PH1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1404608..1405987
Genome map
AA seq 459 aa AA seqDB search
MIVFGSKAEIHAKSILKDGEIPKRWYNILPDLPEPLSPPLDPETNETINPEKLTRIFAKE
LIKQEFSEKRYIKIPKEVRELYAKIGRPTPLFRATNLEKILKTPARIYFKYEGATVTGSH
KINTALAQAYYAKKEGIKRLVTETGAGQWGTALSLAGALIGLKVRVYMTRASYYQKPYRK
ILMEIYGAEVFPSPSENTEVGKRFLREDPNHPGSLGIAISEAIEDVLSDEKARYSLGSVL
NHVLMHQTVIGLEAKKQVKEFEEPDVIIGCVGGGSNFAGLSYPFIKDVLDGKAEYEFIAV
EPRAVPTMTKGVYTYDYGDSAGLTPKIKMYTLGHTYYVPPIHAGGLRYHGLAPTLSVLMN
HGIVKPMAYHQTEVFEAAVLFAKAEGIVPAPESAHAVRAVIDKALEAKRKGEETVILFNL
SGHGLLDLKGYEDYLEGKLEDYEPQILNLSMAPRPPNAL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtttttggatccaaagcagaaatccacgctaagtcaatactgaaggatggagaa
attccaaagagatggtataatatcctaccggatcttccagaacctctaagcccccctctc
gatccagagacgaatgaaacaattaacccagaaaaactaactaggatatttgcaaaagag
ctaataaagcaagaatttagtgagaagaggtacatcaagatacccaaagaggtaagagaa
ctgtatgcaaaaataggaaggcctacaccgctttttagagctacaaatctggagaaaatc
ttgaaaactcctgcaaggatttactttaaatatgaaggagctacagtaactgggagtcac
aagataaataccgcactagcccaagcttattatgccaagaaggaagggatcaaaagactc
gtcactgaaacgggagcaggacagtgggggactgctctaagtttagccggggcattaatt
ggtcttaaagttagagtttacatgaccagggctagttactaccagaaaccgtacagaaag
attctaatggaaatctacggagctgaagtcttcccaagtccgagcgagaacaccgaggta
gggaaaaggttcctcagggaagatccaaatcatccaggaagcttgggaatagccattagc
gaagctatagaagatgttctaagtgatgagaaggccagatattccctggggagcgtttta
aatcatgtcctgatgcatcaaaccgtgattggactagaggccaaaaagcaggttaaagag
ttcgaagagccggatgtaataattggatgcgtaggtgggggaagcaacttcgctggatta
agctacccatttataaaggatgtcctagatggaaaagcggagtacgaatttatagccgtg
gagcccagggccgttccaactatgaccaaaggagtttacacttacgattatggcgattct
gctggcttaacaccaaagataaagatgtataccctagggcacacctactatgttccaccc
atacatgcaggtggattaagataccatggactagcaccaacccttagcgtactcatgaat
cacggaatagtaaagccaatggcatatcatcagacggaggtatttgaagcggccgttctc
tttgcaaaagcggaagggatagttccagcaccggaaagtgcacatgcagttagggcagta
attgataaggcgttagaggccaaaagaaagggagaagaaactgtgatactcttcaatcta
agcggacatggacttttagatttaaaggggtatgaagactatctagaggggaagctcgag
gattacgaacctcaaatcttaaacctaagtatggccccgaggccaccaaatgccctatag

DBGET integrated database retrieval system