KEGG   Pyrococcus horikoshii: PH1598Help
Entry
PH1598            CDS       T00014                                 

Gene name
PH1598
Definition
(GenBank) 503aa long hypothetical pyrimidine-nucleoside phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
pho  Pyrococcus horikoshii
Brite
Enzymes [BR:pho01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     PH1598 (PH1598)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1416497..1418008
Genome map
AA seq 503 aa AA seqDB search
MRAKVKILKIKTGSFNVFISPRDAEEWKLHPNDLVKIESGKRSIYASVAIGDFIEDGEVG
LSQDILSSYQFSEGEVVSITPSGTPESVKYIKKKMKGEKLRKVEIETIIRDIVDRKLRNT
EISAFITAIEINGLSMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVKLSLDEIKRIVEKIGACLVWGGALNLA
PADDLTIHVERRLSLDPRGLMLASIMSKKYAIGSQYILIDIPTGKGAKVETMDEARTLAK
DFIELGKKLGQYVEVAITYGGQPIGYAIGPALEAKEALETLMTGKGPGSLVEKATGLAGI
LLEMGGVAPKGMGKKVAKEILESGKAYEKMKEIIEEQGGDPNIKPEDIPIGDKTYTIHAQ
TGGYVTGIDNRAITAIAREAGAPEDKGAGVRLHVKVGEKVKEGDPLITIHAESESRLEKA
IVLARRLEPIKIEGMVLQVIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagggcaaaagtaaaaattctgaaaataaagactggtagcttcaacgtttttataagc
ccaagagacgctgaagaatggaagcttcatccaaacgacttagtaaaaatagaaagtgga
aaaagatcgatatatgcaagtgtagctattggtgatttcattgaggatggagaagttggg
ctatcccaggatatactatcaagctatcaattttccgagggtgaagtagtttcaataaca
cctagtggaacccccgaaagtgtaaaatacataaaaaagaagatgaaaggagagaaatta
agaaaagtagaaattgagacaataattagagacatcgtggatagaaagcttaggaatact
gaaataagtgcttttattacagctatagaaattaacgggcttagcatggatgagatagca
gcattgacaatcgcaatggccgagacgggagacatgcttgacatagacaggaaacccatt
atggatgttcatagtattggaggggtaccagggaacaagaccaacatcctcgtcgtacct
attgtagcagcagctggtctaacgataccaaagacaagttcaagggcaataacaagtgca
gcaggaacagcagatgtagttgaggtcttaacaaatgttaagctaagtttagatgagatt
aagaggatcgttgaaaagataggggcctgcctcgtatggggaggggctttaaatttggcc
ccagcagatgatttaactattcatgttgagaggaggctaagcctagatccaaggggatta
atgctggcaagtattatgtcaaagaaatatgcgattggcagtcagtatatcctaatagac
attcccacaggaaaaggggcaaaggttgaaacaatggatgaagctagaacactggctaag
gatttcattgagcttggaaagaaactaggacagtacgtcgaagttgccataacatatgga
ggtcagccaataggatacgctataggccccgccctagaagctaaggaggcattagaaaca
ctaatgacaggaaaaggtccagggagtctagttgagaaagccactggattagcgggcata
ttactggagatgggtggagttgctccaaaaggtatgggaaagaaagtggctaaagaaatc
ctggaaagcggaaaagcatacgagaaaatgaaggaaattatagaagagcagggaggagat
cctaatattaagcctgaagatattcccattggagataaaacctatacaatccacgctcag
accggaggatatgtaactggaatagataatagggccataacagctatagccagggaagca
ggggcaccagaggataaaggagcgggtgtaaggttacatgtaaaggtaggggagaaagtc
aaagaaggggatcccttaataacaatacatgcagaaagtgaaagcagactggaaaaagca
atagtcctggcaagaaggcttgaacctataaagatagaaggaatggttcttcaggtaatt
ggaaacatttaa

DBGET integrated database retrieval system