KEGG   Pyrococcus horikoshii: PH1598Help
Entry
PH1598            CDS       T00014                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pho  Pyrococcus horikoshii
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pho00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1416497..1418008
Genome map
AA seq 503 aa AA seqDB search
MRAKVKILKIKTGSFNVFISPRDAEEWKLHPNDLVKIESGKRSIYASVAIGDFIEDGEVG
LSQDILSSYQFSEGEVVSITPSGTPESVKYIKKKMKGEKLRKVEIETIIRDIVDRKLRNT
EISAFITAIEINGLSMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVLTNVKLSLDEIKRIVEKIGACLVWGGALNLA
PADDLTIHVERRLSLDPRGLMLASIMSKKYAIGSQYILIDIPTGKGAKVETMDEARTLAK
DFIELGKKLGQYVEVAITYGGQPIGYAIGPALEAKEALETLMTGKGPGSLVEKATGLAGI
LLEMGGVAPKGMGKKVAKEILESGKAYEKMKEIIEEQGGDPNIKPEDIPIGDKTYTIHAQ
TGGYVTGIDNRAITAIAREAGAPEDKGAGVRLHVKVGEKVKEGDPLITIHAESESRLEKA
IVLARRLEPIKIEGMVLQVIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagggcaaaagtaaaaattctgaaaataaagactggtagcttcaacgtttttataagc
ccaagagacgctgaagaatggaagcttcatccaaacgacttagtaaaaatagaaagtgga
aaaagatcgatatatgcaagtgtagctattggtgatttcattgaggatggagaagttggg
ctatcccaggatatactatcaagctatcaattttccgagggtgaagtagtttcaataaca
cctagtggaacccccgaaagtgtaaaatacataaaaaagaagatgaaaggagagaaatta
agaaaagtagaaattgagacaataattagagacatcgtggatagaaagcttaggaatact
gaaataagtgcttttattacagctatagaaattaacgggcttagcatggatgagatagca
gcattgacaatcgcaatggccgagacgggagacatgcttgacatagacaggaaacccatt
atggatgttcatagtattggaggggtaccagggaacaagaccaacatcctcgtcgtacct
attgtagcagcagctggtctaacgataccaaagacaagttcaagggcaataacaagtgca
gcaggaacagcagatgtagttgaggtcttaacaaatgttaagctaagtttagatgagatt
aagaggatcgttgaaaagataggggcctgcctcgtatggggaggggctttaaatttggcc
ccagcagatgatttaactattcatgttgagaggaggctaagcctagatccaaggggatta
atgctggcaagtattatgtcaaagaaatatgcgattggcagtcagtatatcctaatagac
attcccacaggaaaaggggcaaaggttgaaacaatggatgaagctagaacactggctaag
gatttcattgagcttggaaagaaactaggacagtacgtcgaagttgccataacatatgga
ggtcagccaataggatacgctataggccccgccctagaagctaaggaggcattagaaaca
ctaatgacaggaaaaggtccagggagtctagttgagaaagccactggattagcgggcata
ttactggagatgggtggagttgctccaaaaggtatgggaaagaaagtggctaaagaaatc
ctggaaagcggaaaagcatacgagaaaatgaaggaaattatagaagagcagggaggagat
cctaatattaagcctgaagatattcccattggagataaaacctatacaatccacgctcag
accggaggatatgtaactggaatagataatagggccataacagctatagccagggaagca
ggggcaccagaggataaaggagcgggtgtaaggttacatgtaaaggtaggggagaaagtc
aaagaaggggatcccttaataacaatacatgcagaaagtgaaagcagactggaaaaagca
atagtcctggcaagaaggcttgaacctataaagatagaaggaatggttcttcaggtaatt
ggaaacatttaa

DBGET integrated database retrieval system