KEGG   Pyrococcus horikoshii: PH1627Help
Entry
PH1627            CDS       T00014                                 

Gene name
PH1627
Definition
(GenBank) 346aa long hypothetical threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00260  Glycine, serine and threonine metabolism
pho00750  Vitamin B6 metabolism
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01120  Microbial metabolism in diverse environments
pho01230  Biosynthesis of amino acids
Module
pho_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PH1627 (PH1627)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PH1627 (PH1627)
Enzymes [BR:pho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PH1627 (PH1627)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zf-C2HC_2
Motif
Other DBs
NCBI-ProteinID: BAA30739
UniProt: O59293
Position
complement(1443536..1444576)
Genome map
AA seq 346 aa AA seqDB search
MILMLICSKCGRKFEEKFILRCTCGGTLLVKRKYDSFAPRKFLDIRRYIDYLPVDEKFLP
SLTPGITPISKISDEVYLKLDYLQPTGSFKDRGTYVTVAKIKEEGIDEVVIDSSGNAGLS
LATYGMAEGIKVHVFLSYNAKPEKIARLNSVNARLHFVEGDRMRVHEEAVKFSERTGIPY
ASHWLNPYFLEGTKTIAFEIYEQIGIPRYIFVPVGSGTAFLGIWKGFKELLEMGEINKMP
SLVAVQAEGYESLCKRSKSVNKLADGIAIPNPPRIEEMKVALRETSGFCISVGEEETLAG
YHWLRRNGFFIEETSATALAGYWKAREKGLVKGSSLLLLTGSAKSF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgattttaatgttaatttgctctaaatgcgggaggaaatttgaagaaaaatttatacta
agatgcacttgtggtgggactttactcgttaaaaggaagtacgatagctttgctccaaga
aagtttctggatattagaaggtacattgattacttacctgttgatgagaagtttttacca
tcattaactccaggtatcactcccataagtaagatctctgacgaagtgtatttgaagctt
gactatctacaaccgactggctcctttaaggatagggggacttatgttacagttgcaaag
ataaaagaagaaggaattgatgaagtagtcattgatagctctggaaacgccggattgagt
ttagccacttatggcatggccgaaggaataaaggttcatgtgttcttatcttacaatgca
aaaccagagaagatagcaagattaaattctgtaaacgctagattgcacttcgttgagggg
gatagaatgagagtccatgaggaggccgtgaagttctcagagaggacaggtattccttat
gcatctcattggttaaacccctacttcctggaagggactaagactatagcctttgaaata
tatgagcagattggaatccctaggtatatattcgttccagttgggagtggaacggcattc
ttagggatatggaaagggttcaaagagttacttgaaatgggggaaatcaataaaatgcca
tccctcgttgcagtccaggccgagggatatgaaagcttatgcaagagatctaagagtgtt
aacaaacttgcagacggaatagcaattcccaatcctccgagaattgaggaaatgaaagtt
gctctgagggagacctctggtttttgcattagtgttggtgaagaagaaacgctggcagga
tatcattggcttaggagaaatggtttctttattgaagaaacatcggcaaccgctcttgct
ggttactggaaggcaagggaaaaaggattagtaaaaggttcttcattattactattaacg
ggttcggctaagagtttttag

DBGET integrated database retrieval system