KEGG   Pyrococcus horikoshii: PH1739Help
Entry
PH1739            CDS       T00014                                 

Definition
hypothetical protein
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH1739
   00620 Pyruvate metabolism
    PH1739
   00640 Propanoate metabolism
    PH1739
Enzymes [BR:pho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     PH1739
Lipid biosynthesis proteins [BR:pho01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PH1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1525322..1525960)
Genome map
AA seq 212 aa AA seqDB search
MDRIARAREIIEKAKAENRSLVEPEAKEILKLYGIPIPEFKVARNEEEAVKFSREIGYPV
VMKIVSPQIIHKSDAGGVKINIKNDEEAREAFRTIMENARRYKPDADLWGVIIYKMLPLG
REVIVGMIRDPQFGPAVMFGLGGIFVEILKDVSFRVAPISKDDALEMIKEIKAYPILAGA
RGEKPVNIEALADIIVKVGELALEFLKLENSI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggatagaatagcaagagctagggaaattattgaaaaagcaaaggctgagaatagatca
ctagttgaacctgaggccaaggagattctcaagctttatggaattccaattccagaattt
aaggttgcaaggaacgaggaagaggccgtaaaattctctagggagattggatatccggta
gttatgaagatagtttcacctcaaataattcataagagcgatgctggtggcgttaagata
aacataaagaacgatgaagaagccagggaagccttcagaacaataatggaaaatgcaagg
aggtacaagccagatgccgatctttggggtgttataatttataagatgctacccctaggt
agagaggtcatagtgggaatgataagggatccacagtttggacccgcggtaatgtttgga
ttaggtggaatattcgttgaaatattaaaggatgttagctttagagtcgctcctatatct
aaggacgatgctctagaaatgatcaaggagattaaagcctatccaattttagctggagct
agaggagaaaagcctgtgaatattgaggcattggcagatataatcgttaaggttggagaa
ttggcccttgagttcctgaaattagagaactcgatataa

DBGET integrated database retrieval system