KEGG   Pyrococcus horikoshii: PH1739Help
Entry
PH1739            CDS       T00014                                 

Gene name
PH1739
Definition
(GenBank) 212aa long hypothetical protein
  KO
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00010  Glycolysis / Gluconeogenesis
pho00620  Pyruvate metabolism
pho00640  Propanoate metabolism
pho01100  Metabolic pathways
pho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH1739 (PH1739)
   00620 Pyruvate metabolism
    PH1739 (PH1739)
   00640 Propanoate metabolism
    PH1739 (PH1739)
Enzymes [BR:pho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     PH1739 (PH1739)
Lipid biosynthesis proteins [BR:pho01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PH1739 (PH1739)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 ATP-grasp_2 GARS_A ATP-grasp CPSase_L_D2 DUF5126 RimK Fer4_NifH
Motif
Other DBs
NCBI-ProteinID: BAA30853
UniProt: O59378
Position
complement(1525322..1525960)
Genome map
AA seq 212 aa AA seqDB search
MDRIARAREIIEKAKAENRSLVEPEAKEILKLYGIPIPEFKVARNEEEAVKFSREIGYPV
VMKIVSPQIIHKSDAGGVKINIKNDEEAREAFRTIMENARRYKPDADLWGVIIYKMLPLG
REVIVGMIRDPQFGPAVMFGLGGIFVEILKDVSFRVAPISKDDALEMIKEIKAYPILAGA
RGEKPVNIEALADIIVKVGELALEFLKLENSI
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggatagaatagcaagagctagggaaattattgaaaaagcaaaggctgagaatagatca
ctagttgaacctgaggccaaggagattctcaagctttatggaattccaattccagaattt
aaggttgcaaggaacgaggaagaggccgtaaaattctctagggagattggatatccggta
gttatgaagatagtttcacctcaaataattcataagagcgatgctggtggcgttaagata
aacataaagaacgatgaagaagccagggaagccttcagaacaataatggaaaatgcaagg
aggtacaagccagatgccgatctttggggtgttataatttataagatgctacccctaggt
agagaggtcatagtgggaatgataagggatccacagtttggacccgcggtaatgtttgga
ttaggtggaatattcgttgaaatattaaaggatgttagctttagagtcgctcctatatct
aaggacgatgctctagaaatgatcaaggagattaaagcctatccaattttagctggagct
agaggagaaaagcctgtgaatattgaggcattggcagatataatcgttaaggttggagaa
ttggcccttgagttcctgaaattagagaactcgatataa

DBGET integrated database retrieval system