KEGG   Pyrococcus horikoshii: PH1830Help
Entry
PH1830            CDS       T00014                                 

Gene name
PH1830
Definition
(GenBank) 334aa long hypothetical glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00010  Glycolysis / Gluconeogenesis
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01120  Microbial metabolism in diverse environments
pho01130  Biosynthesis of antibiotics
pho01200  Carbon metabolism
pho01230  Biosynthesis of amino acids
Module
pho_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pho_M00002  Glycolysis, core module involving three-carbon compounds
pho_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH1830 (PH1830)
Enzymes [BR:pho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     PH1830 (PH1830)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3 Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: BAA30950
UniProt: O59494
Structure
PDB: 

Jmol
Position
1591416..1592420
Genome map
AA seq 334 aa AA seqDB search
MKVKVGVNGYGTIGKRVAYAVTKQDDMELIGITKTKPDFEAYRAKELGIPVYAASEEFIP
RFEKEGFEVAGTLNDLLEKVDIIVDATPGGIGAKNKPLYEKAGVKAIFQGGEKADVAEVS
FVAQANYEAALGKNYVRVVSCNTTGLVRTLSAIREYADYVYAVMIRRAADPNDTKRGPIN
AIKPTVEVPSHHGPDVQTVIPINIETMAFVVPTTLMHVHSVMVELKKPLTKDDVIDIFEN
TTRVLLFEKEKGFDSTAQIIEFARDLHREWNNLYEIAVWKESINIKGNRLFYIQAVHQES
DVIPENIDAIRAMFELADKWDSIKKTNKSLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaaaggttggagtgaatgggtatggaacgataggaaagagagttgcttatgca
gtgacaaagcaagatgacatggagttaatcggtattacaaaaactaagcctgattttgaa
gcttacagggctaaagaactcggaattcccgtatacgcagctagtgaagaattcatccca
aggtttgaaaaggaaggattcgaagttgccggaacgcttaatgatttgcttgagaaagtt
gatataatagtggatgcaaccccgggaggaataggagctaaaaataagcccctttatgaa
aaagccggtgtaaaggcgatatttcaagggggagaaaaagctgatgtcgcagaggtatcc
ttcgttgctcaagcaaattatgaggcagcacttggaaagaactacgttagagttgtctca
tgtaacaccacgggattagttagaaccctgagcgcaatcagagagtacgctgattacgtc
tacgcggttatgataaggagagctgctgatccaaatgatacaaagagaggtccgataaat
gctataaaaccaacagttgaagttccctcacaccacggacctgatgttcaaactgtaatt
ccaataaacatagaaactatggcatttgtagttccaacaacccttatgcatgttcactca
gttatggtagagctgaagaaacctctaactaaggatgatgtaattgacatatttgagaac
acgacaagggtcctgctctttgagaaggagaagggcttcgatagcacggcccaaataata
gagttcgcaagagatctgcacagggaatggaataacctatacgagatagccgtttggaag
gaaagcataaacataaaagggaatagattattctacatccaggccgttcaccaggagagc
gacgtaattcctgagaacatagatgcaataagggccatgtttgaactagcagataagtgg
gatagcataaagaagacaaataagagcttaggaattctcaagtag

DBGET integrated database retrieval system