KEGG   Pyrococcus horikoshii: PH1845Help
Entry
PH1845            CDS       T00014                                 

Gene name
PH1845
Definition
(GenBank) 296aa long hypothetical ribokinase
  KO
K21056  
alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pho  Pyrococcus horikoshii
Brite
Enzymes [BR:pho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     PH1845 (PH1845)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1603951..1604841
Genome map
AA seq 296 aa AA seqDB search
MRLDVICMGNLNYDITFILERFPEFHEKVNAKEVYTGLGGSAGNTATWLSLLGLKVGFIG
SVGNDDFGRLHLEFFKKIGVDTRGIKVVDEPTGVAVMMVIGEDKRIVKYPGANRFKEVRE
DYLKLARHLHLSSNPLSLVEKAVTLAKNLGLTVSFDPGEMEVPKNIEEKVDILMMNEDEF
KRKYGDLKNITKVKSRIAIATLNGGGALVRDQNGKVYEVRGLSAKAVDTTGGGDSFNAGF
IYGFLNGWDVVSSAKLGMLLAYLTVQKVGARSAVIPLEEVKKKANELNLDLPFNSS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagactggatgtaatttgtatggggaacctcaactatgacataactttcatacttgaa
agatttccagagttccacgaaaaggtgaatgctaaagaagtttatacgggattaggaggt
tccgcaggaaatacagcgacttggttgtctctcctaggattaaaggttggtttcataggt
tctgtgggaaatgacgactttggaaggttgcatctggaattctttaagaaaattggagta
gatactagagggattaaagtcgtagacgaaccaacgggagtcgccgtaatgatggtgatc
ggagaagacaaaaggatagttaagtaccctggggccaataggtttaaggaggtaagagag
gactatttgaagcttgccaggcatttgcacctctcttcaaatcccctttcacttgtcgaa
aaagctgtaaccttggccaaaaatcttggcctaactgtttcttttgatccaggagaaatg
gaagtcccaaagaatattgaagaaaaagtagacatcttaatgatgaacgaagatgagttc
aagaggaagtatggagacttaaaaaatataactaaagttaagtctagaatagccatagca
acgctaaacggtggaggagctctggttagagatcaaaatggaaaagtttacgaggtaagg
ggactgtcggcaaaggccgtagataccaccggtggtggagactcttttaatgctggattt
atatatggctttctaaatggctgggatgtggtaagttcagcaaaattaggaatgctactt
gcttaccttacagttcaaaaagtaggagcaagaagtgcggtaattcccctagaggaagtt
aaaaagaaagcaaatgaattaaacctagatcttccatttaatagctcttaa

DBGET integrated database retrieval system