KEGG   Pyrococcus horikoshii: PH1867Help
Entry
PH1867            CDS       T00014                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pho  Pyrococcus horikoshii
Brite
Enzymes [BR:pho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PH1867
Transfer RNA biogenesis [BR:pho03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PH1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621169..1623022)
Genome map
AA seq 617 aa AA seqDB search
MMRNRGAEAMMRSANADFPNIYKQIYREAGKMREAIVEIVEALLSGKVKSREELNKLKIE
VARKYHLPKLPKNSDIWKALPKDKREKFRDLLKKKPARTISGVAVVAMMTKPFPCPHGRC
IYCPGGPSVGSPQSYTGKEPSALRASQYGYHPYIIMMARLKQLYDIGHPIDKVEVIIQGG
TFPAVDLDYQEWFVKCAFKAMNDFHYFKDIDNLEEKLVRLILKGDKSVFKEDPEFKRAWE
RTHRKPYYYLEDEQRKNEKAKVRMVGLTIETRPDWAFERQIDRMLSFGTTRVELGVQTIF
NFIHERTKRGHGVEEIIKATQLLKDAGLKVNYHIMPGLPGSNFDRDLYTFRTIFEDPRFR
PDMLKIYPTLVTRDAPLYAWYKAGLYRPYTTEEALELLVEAYKIFPKWVRVMRIQRDIPA
HLIVAGVKHSNLGQLVFNELVRRGIRPREIRFREVGHQMQKFGKIPEVEHIKLLREDYEA
SEGQEIFLSFEDVKNDILIGFLRLRIPSEKAHRKEINCCPSAIVRELHVYGPLVPIGEKP
KYEWQHRGYGRELLSEAERIAREEFDAKKILVISGVGVREYYRKFGYRKDGPYVSKRLDK
SYADYERVNKFDAHLNT
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaggaatcggggagctgaagctatgatgagatccgccaacgctgattttccaaat
atttataagcaaatttatagagaggctgggaagatgagagaagcaatagttgagattgtg
gaagctctgctctctggaaaggtgaaaagtagggaggagttaaacaaattaaaaatagag
gtggccaggaagtatcatcttcctaagctccctaagaattccgatatatggaaggcccta
ccaaaggacaagagggaaaaatttagagatctattgaagaagaagcctgctagaactata
agtggagttgcagtcgttgcaatgatgacgaagcctttcccttgccctcatggaaggtgt
atatattgcccaggtggcccaagcgttggttctccacagagctacaccggaaaggaaccc
tcagcgttaagggcttcccagtatggttaccatccctatataatcatgatggccagactt
aagcaattatacgacataggtcatccaatagataaggttgaggttataatccagggagga
acttttcctgcggtggacttggattatcaggagtggttcgttaagtgtgcattcaaggcc
atgaacgactttcactactttaaggatattgataacttggaggaaaagctcgttagactg
atattaaagggtgataaatcagttttcaaagaggatcctgaatttaaaagggcctgggag
agaacccacaggaagccttattactaccttgaagatgagcaaaggaaaaatgagaaagct
aaagttaggatggttggattaacaatagagacgagaccggattgggcctttgaaagacaa
attgataggatgttaagctttggaacaacaagagtggaacttggggttcaaacaatattc
aactttatacacgagagaaccaagcgtggccatggagttgaggaaattattaaggctacc
cagttattaaaagacgctggacttaaggtgaattatcatataatgcctggcctccctggg
agcaacttcgatagggatctttatacctttagaacgatatttgaagatcctaggtttagg
cctgacatgcttaaaatataccccaccctagtcaccagggatgctcccctttatgcctgg
tacaaggcgggtctttataggccatacacaactgaagaagctcttgagcttctagttgag
gcttataagatttttccaaagtgggttagggttatgagaattcaaagggatatacctgct
cacctaatagtcgctggagtgaagcactcgaatcttggtcagctcgttttcaacgagctg
gtgaggcggggaataaggccaagggagataaggtttagggaagttggacatcagatgcag
aagttcggtaaaatccccgaggtagagcatataaaattgctaagggaggactatgaagct
tccgagggtcaagaaatattcttaagctttgaagatgtcaaaaatgacattttaataggc
tttttaaggcttaggattccaagtgagaaggcccacagaaaagagataaactgttgtcca
tccgctatagtcagagaacttcacgtttatggtcccctagttccaataggggagaagcct
aagtatgaatggcaacatagaggttatgggagggagttactatctgaggccgaaaggata
gctagggaggaatttgatgcaaagaagatcctagttattagcggagttggcgttagggag
tactacaggaagtttggctataggaaagatggaccttatgttagtaaaaggctagataaa
agttatgccgactacgagagggtaaataagttcgacgctcaccttaatacttga

DBGET integrated database retrieval system