KEGG   Pyrococcus horikoshii: PH1884Help
Entry
PH1884            CDS       T00014                                 

Gene name
PH1884
Definition
(GenBank) 231aa long hypothetical triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PH1884 (PH1884)
   01230 Biosynthesis of amino acids
    PH1884 (PH1884)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH1884 (PH1884)
   00051 Fructose and mannose metabolism
    PH1884 (PH1884)
   00562 Inositol phosphate metabolism
    PH1884 (PH1884)
Enzymes [BR:pho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PH1884 (PH1884)
Exosome [BR:pho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PH1884 (PH1884)
  Exosomal proteins of bladder cancer cells
   PH1884 (PH1884)
  Exosomal proteins of melanoma cells
   PH1884 (PH1884)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1638174..1638869)
Genome map
AA seq 231 aa AA seqDB search
MVPMKLDEPIIAINFKTYIEATGKRALEIAKAAERVYKETGVTIVVAPQLVDLRMIAENV
EIPVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAISRAKEVGL
ITMVCSNNPAVSAAVAALEPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVRKVNPKVK
VLCGAGISTGEDVRKAIELGTVGVLLASGVTKAKDPEKAIRDLVSGIIGKD
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggttcccatgaagcttgatgaaccaattatagcaataaattttaagacctacatagag
gccaccggaaagagggctttagagatagcaaaggccgctgaaagggtttacaaggaaact
ggagttaccatagttgtcgctccccagctcgtcgacctaaggatgatagctgagaatgtt
gagatacctgtttttgctcagcatatagatcctataaaacctggaagtcacaccggtcat
gttctccctgaggccgttaaagaggctggagcggttggaacgctattgaatcattcagag
aacagaatgattctcgcggaccttgaagctgcaatctcaagggctaaagaggtgggacta
attacaatggtctgctcaaataatccagcagtttcagcggccgtagctgctcttgagcca
gactacgtcgctgttgagccgccagagctcattggaacgggaatacctgtaagcaaggct
aagccagaggttataacgaacacagttgagctcgtgagaaaggtaaatccaaaggttaaa
gtcctctgcggtgccgggataagtacgggtgaagacgtaaggaaggctatagaacttgga
actgttggagttcttttagctagtggcgttacaaaagctaaggatccagaaaaggcaata
agagatttagtgtccggaataataggaaaagattaa

DBGET integrated database retrieval system