KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM001030Help
Entry
Phum_PHUM001030   CDS       T01223                                 

Definition
mitogen-activated protein kinase ERK-A, putative (EC:2.7.12.2)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Phum_PHUM001030
Protein kinases [BR:phu01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   Phum_PHUM001030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 323 aa AA seqDB search
MSDATSKSKQKSIQFKTCNDTPRKLLSIPPSPFLEKLGYGTGVNVWKLSHSPNSVKSPWA
IKNVRKCVNKELSDKYQSLLTKEANILRSLDHENIIGFRGYLKSEDGRNCLAMEVGGESL
GDLLEKRFENDLGPFPPDIIIKVAYSIAKALNYLHNEKNILHGDIKPYNVVIKNNFEDIK
LCDFGVSIKLNDENITEKYVGTPIYSAPECIKGDKKTITEKSDIFSFGLILWEMIALFPP
HTEDLINKNESALNSDDSLYTHVSDSEIEENYGTRPLLPPCELGSEYKYVLELFYACTEQ
DPDKRPSASSIIDYINMINKTNT
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgccacttcaaaatccaaacaaaaatcaattcaatttaaaacttgtaacgac
acgcctagaaagcttttatcgattcctccatctccatttttagaaaagttgggttatggt
acaggagttaacgtttggaagttaagtcattctcctaacagtgtcaaatctccatgggcc
attaaaaatgttagaaaatgtgtaaataaagaattatctgataaatatcaatcacttctt
actaaggaagcaaatatattaagatcattggatcatgaaaacataattggttttagagga
tatttaaaatcagaagatggaagaaattgtttagccatggaagtcggtggagagagttta
ggagatttattagaaaaaagatttgaaaatgatttgggtccatttccacctgacataatt
attaaagttgcttacagcatagcgaaagcattaaattatttacataatgaaaaaaatata
cttcatggtgacataaaaccatataatgtggttattaaaaataattttgaagatattaaa
ctctgcgattttggagtttccattaaattaaatgatgaaaatataacagaaaaatatgtt
ggtactcccatatacagtgcacccgaatgcatcaaaggtgataaaaaaacgataacagag
aaatcggatatattttcattcggtttgattttatgggaaatgattgcattatttccacca
cacacagaagatctcattaataaaaatgaatctgctcttaattctgatgattctttatac
acacatgtaagcgatagcgaaattgaagaaaattatggtactcgtcctttattgccacct
tgtgaactaggatcagagtataaatatgttttggaattattttatgcatgtacagaacaa
gatcccgataagagaccttctgcatcatccataattgattacataaatatgataaacaaa
actaatacataa

DBGET integrated database retrieval system