KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM002680Help
Entry
Phum_PHUM002680   CDS       T01223                                 

Definition
(RefSeq) DNA double-strand break repair Rad50 ATPase, putative
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu04137  Mitophagy - animal
phu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:phu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Phum_PHUM002680
   04137 Mitophagy - animal
    Phum_PHUM002680
Enzymes [BR:phu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Phum_PHUM002680
Peptidases [BR:phu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Phum_PHUM002680
Membrane trafficking [BR:phu04131]
 Endosome - Lysosome transport
  Others
   Others
    Phum_PHUM002680
Ubiquitin system [BR:phu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Phum_PHUM002680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 USP8_dimer Dak2
Motif
Other DBs
NCBI-GeneID: 8233334
NCBI-ProteinID: XP_002422594
VectorBase: PHUM002680
UniProt: E0V900
AA seq 870 aa AA seqDB search
MAGKENKSPFKFKSLEELKPHYDRLQLAGKNPRDLMHKLDKIFKTACEKMANEEIEDAYI
LIMKYLNVFSFIQKSDDFKEDSKYYKAMLGKQPKDALKIAENLHKNLSEYYSMVKNIEAS
EHKKEKGNFKNSNLNIEMPDMRVQKESKSTVTSAKLFTMLRDGITKVLLMDTRPQLDFES
SRIKDNMMNIPDEIITTGANMLEKQLPEASKNLWKLRGTYDQIWDVNTKYKNEILILDGG
YEDWLNSYPWNTTNPKPQRPVYEETISEDVLDQVVYPDLDDVNANVDQEFLKPFFDKTKK
PFKRSLIESDQDEFPSDQSTRPSFDRAKKAAAIKTYEERKSELANLLNQKVKETSEALVI
EKTMLDNEKELQETIKEYKNADEVKKKILEEKEEKLLMKVEELKEESILKDEKIKELQKI
IEIYEKKDIEEMARKVEDEERRIREAEINEKIRLQEEEKLRIAKEREEIEKIKMLERKKL
EEKYKEKLEIARSKKKKVSDNNFTNPSNLTLANDIYNKVPVINRSNKPRLDEKIRQFNGV
KGNVVRNTCYLNSIVQCISNNPALVKYFCDNLYRNDLHKGNKTKGEVAEELAALVKTLWS
GQFRSIACRDFKNTVGMFKPEYATYEQQDSHEFLTFLMDWLHNDLNKSTFGSMDSEKLDN
DMEKAWWDFKKKNISLISTLFYGLQKSTVSCTKCDEASVTYEPFSNLSLIIPDSEYSSTE
QCLGLYLKSERISGWRCPKCKEFRDAEKKTDICILPPILIIHLKRFHYIEVLSRKRTSFV
DFPLTDLNMSQYVGCIKQRHINYDLYAISNHYGTMEGGHYTAYCKSPLYKRWYKFDDHEV
FEISSNDVKSNAAYILFYTSINYRISDPPS
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaagaaaataaatctccttttaaatttaaaagcttggaagaattaaaacca
cactacgatagacttcaattagctggaaaaaatccaagagatttaatgcacaaattagat
aaaatatttaaaaccgcgtgtgaaaaaatggccaatgaagaaatagaagatgcttatatt
ttaattatgaaatacttaaatgttttttcatttattcaaaaatctgatgatttcaaggaa
gattccaagtattataaagccatgcttggaaagcaaccaaaagatgcacttaaaatagct
gaaaatttacataaaaatcttagtgaatattatagtatggttaaaaatatagaagcaagt
gagcacaagaaagaaaaaggaaattttaaaaactctaaccttaatatagaaatgcctgac
atgagagtacaaaaagagtcaaaatcaactgttaccagtgcaaagttgtttaccatgcta
agagatggtataactaaggtactgctaatggataccagacctcaattggattttgaaagt
tctagaataaaagataatatgatgaacattcctgatgaaataattactactggtgctaat
atgttagaaaaacaattacctgaggcatctaaaaatttatggaaactcagaggaacttat
gaccaaatatgggatgtcaacacaaaatataaaaatgaaattttaatacttgatggtggc
tacgaagattggcttaatagctacccttggaatactacaaatcctaaacctcaaaggcca
gtttatgaagaaacaatttctgaagatgttttagatcaagtggtttatcctgatttggat
gatgtaaatgcaaatgttgatcaagaattcttaaaaccattttttgataaaactaaaaag
ccctttaagcgttcattaattgaaagcgaccaggatgaatttccatctgatcaatctact
cgcccaagtttcgatagagcaaaaaaggctgctgctatcaaaacctatgaggaacgtaaa
tcagaactggcaaatttattaaaccaaaaagttaaagaaacttctgaagcgttggtaatt
gaaaaaaccatgcttgataatgaaaaagaacttcaagaaaccataaaggaatacaaaaat
gctgatgaagtaaaaaaaaaaattttggaggaaaaggaagaaaaattacttatgaaagta
gaagagttaaaagaagaatcaattttaaaagatgaaaaaataaaagaattgcaaaaaatt
attgaaatctacgaaaaaaaagatattgaagaaatggctagaaaagtcgaagatgaagaa
aggcgaattcgcgaagcagaaattaatgaaaaaataagattacaagaagaagagaaactt
agaattgcaaaagaaagagaagaaattgaaaaaattaagatgctggaaaggaaaaaatta
gaagaaaaatataaagaaaaacttgaaattgccaggagtaagaaaaaaaaagtatcagac
aacaattttacaaatccatcaaacttgacattggccaatgatatttataacaaagttccg
gtaataaatagaagtaataaaccaagactcgatgaaaaaataaggcaatttaatggggtt
aaaggcaatgtggtacgaaatacatgttatctaaattcaattgttcaatgtattagtaat
aatcccgcattagttaaatatttttgcgacaatctttataggaacgatttgcataaagga
aataaaacaaaaggtgaagtggcggaagaattggcggctttagttaaaactctatggtcg
ggtcagtttcgttcgattgcatgtcgagattttaaaaatacagtaggcatgtttaagcct
gaatacgctacgtatgagcaacaagactctcatgaatttttaacatttttaatggattgg
cttcataacgatttaaataagtcgacgtttggatcgatggatagtgaaaaattggacaac
gacatggaaaaagcttggtgggattttaaaaaaaaaaatatatctttaatatcaacgtta
ttttatggccttcaaaaatcaaccgtttcttgtactaaatgcgatgaagcatccgttaca
tacgagcctttttctaatttgtctttaatcattcccgattcggaatacagttcaaccgaa
caatgcctcggcctttatttaaaaagtgaaagaatatccggttggcgttgtccgaaatgt
aaagaatttcgggatgccgaaaaaaagactgatatttgcattcttcctcccattttaatt
attcaccttaaaagatttcactacattgaagttttgtcccggaaaagaacatctttcgtt
gattttcctctaacggatttaaacatgtcgcaatatgtcggttgtataaaacaaaggcat
ataaattacgatttgtatgctatttccaatcattatggaacaatggaaggtggtcattac
acagcttattgcaaaagtcccctttacaaaagatggtacaaattcgacgatcacgaagtc
tttgaaatatcttcaaacgatgttaaaagcaacgcagcttacattttattttacacttca
attaattatagaatttcagatccgccaagttga

DBGET integrated database retrieval system