KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM003530Help
Entry
Phum_PHUM003530   CDS       T01223                                 

Definition
histone H2B.3, putative
Orthology
K11252  
histone H2B
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Exosome [BR:phu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Phum_PHUM003530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 156 aa AA seqDB search
MRSDQSLRAPIVPAHSLVGSLGCSRYFFDHCFAMPPKATGKAVKKAGKAQKNISKGDKKK
KRRRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKRSTI
TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccgaccaatcactgcgcgcgccgattgttcctgcgcattcattggtcggctcg
ctcggttgctcgcgctatttttttgatcattgttttgcaatgccgcccaaagcaaccgga
aaggccgtcaaaaaggccggaaaggctcagaaaaacatttccaagggagacaaaaagaag
aaaaggaggaggaaggaaagttatgccatttacatctacaaagttctcaagcaagttcat
cccgacactggaatttcgagcaaagccatgagcatcatgaactctttcgtaaatgacatt
ttcgaaagaatcgctgctgaagcttccagattatctcactacaacaagagatcgaccatc
actagtcgggaaattcaaacggctgttcgtctcttattgccgggagaattggcaaaacac
gccgtgagtgaaggaaccaaagctgtgaccaaatacacaagttcaaaataa

DBGET integrated database retrieval system